1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. FSH
  5. FSH Protein, Human (HEK293, Flag-His)

Follicle-stimulating hormone (FSH) is a glycoprotein dimer polypeptide hormone produced by the anterior pituitary in response to gonadotropin-releasing hormone (GnRH) from the hypothalamus, which consists of Glycoprotein hormones α chain and Follitropin subunit β. FSH binds to FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. FSH is involved in follicle development and spermatogenesis in reproductive organs. FSH Protein, Human (HEK293, Flag-His) is a recombinant protein with a Flag-His label that consisting of 116 amino acids of Glycoprotein hormones α chain and 129 amino acids of Follitropin subunit β, which is expressed in HEK293 cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Follicle-stimulating hormone (FSH) is a glycoprotein dimer polypeptide hormone produced by the anterior pituitary in response to gonadotropin-releasing hormone (GnRH) from the hypothalamus, which consists of Glycoprotein hormones α chain and Follitropin subunit β. FSH binds to FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. FSH is involved in follicle development and spermatogenesis in reproductive organs. FSH Protein, Human (HEK293, Flag-His) is a recombinant protein with a Flag-His label that consisting of 116 amino acids of Glycoprotein hormones α chain and 129 amino acids of Follitropin subunit β, which is expressed in HEK293 cells[1][2][3][4][5][6][7][8][9].

Background

FSH Protein (Human) is a glycoprotein dimer with α and β subunits. The β subunit is unique to FSH, while the α subunit is shared as same as in thyroid stimulating hormone (TSH), choriogonadotropin (CG) and luteinizing hormone (LH)[1].
Follicle growth is directly dependent on FSH Protein (Human) stimulation. Granulosa cells from small follicles express FSH Protein (Human) receptors and respond to FSH Protein (Human) stimulation by synthesizing aromatase[1].
FSH Protein (Human) release is stimulated by gonadotropin-releasing hormone (GnRH): The hypothalamus produces GnRH, and it is released into the hypophyseal portal circulation to act on G-protein-coupled receptors at gonadotropic cells of the anterior pituitary. Gonadotropic cells produce FSH and luteinizing hormone (LH) and release them into the peripheral circulation[4].
FSH Protein (Human) regulates the development, growth, pubertal maturation and reproductive processes of the human body. FSH Protein (Human) is used commonly in infertility therapy, mainly for ovarian hyperstimulation. In some cases, it is used in ovulation induction for reversal of anovulation as well[5].
FSH Protein (Human) secretion is inhibited by negative feedback from estrogen levels in women and FSH Protein (Human) secretion is inhibited by levels of inhibin B (secreted by the Sertoli cells) via negative feedback in men[5,6].
FSH Protein (Human) Levels are associated with various diseases, such as Polycystic Ovarian Syndrome, male infertility, hypogonadotropic hypogonadism, Kallman Syndrome, Turner Syndrome, pituitary adenomas, and more[1,7,8,9].

In Vitro

The serum level of FSH Protein (Human) (13.7, 24.1 and 69 IU/L) increases as ovarian function declines, which acts a better predictor of in vitro fertilization (IVF) performance than age[3].

In Vivo

The plasma concentration of FSH Protein (Human) is profoundly reduced when a variety of α-adrenergic blocking agents interrupts the pulsatile discharges in ovariectomized rhesus monkeys, which suggests the production and secretion of FSH are critically dependent on hypothalamic GnRH[3].

Biological Activity

Measured in a cell proliferation assay using SK-OV-3 cells. The ED50 for this effect is 0.048 ng/mL, corresponding to a specific activity is 2.083×107 units/mg.

  • Measured in a cell proliferation assay using SK-OV-3 cells. The ED50 for this effect is 0.048 ng/mL, corresponding to a specific activity is 2.083×107 units/mg.
Species

Human

Source

HEK293

Tag

C-Flag;C-6*His

Accession

P01215 (A25-S116)&P01225 (N19-E129)

Gene ID

1081  [NCBI]&2488  [NCBI]

Synonyms
rHuFollicle-stimulating hormone/FSH, Flag-His; Follicle-stimulating hormone; FSH; FSH alpha/beta
AA Sequence

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS&NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

Molecular Weight

Approximately 19-30 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

FSH Protein, Human (HEK293, Flag-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FSH Protein, Human (HEK293, Flag-His)
Cat. No.:
HY-P70237
Quantity:
MCE Japan Authorized Agent: