1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. FXN Protein, Mouse (His)

FXN protein is a key activator in the core iron-sulfur cluster (ISC) assembly complex, accelerating persulfide transfer to ISCU and [2Fe-2S] cluster assembly. It promotes sulfur transfer, leading to oversulfidation and sulfide release. FXN Protein, Mouse (His) is the recombinant mouse-derived FXN protein, expressed by E. coli , with N-6*His labeled tag. The total length of FXN Protein, Mouse (His) is 130 a.a., with molecular weight of ~19.9 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FXN protein is a key activator in the core iron-sulfur cluster (ISC) assembly complex, accelerating persulfide transfer to ISCU and [2Fe-2S] cluster assembly. It promotes sulfur transfer, leading to oversulfidation and sulfide release. FXN Protein, Mouse (His) is the recombinant mouse-derived FXN protein, expressed by E. coli , with N-6*His labeled tag. The total length of FXN Protein, Mouse (His) is 130 a.a., with molecular weight of ~19.9 kDa.

Background

The FXN protein operates as a pivotal activator within the core iron-sulfur cluster (ISC) assembly complex, orchestrating persulfide transfer to the scaffolding protein ISCU and participating in [2Fe-2S] cluster assembly. FXN accelerates sulfur transfer from the NFS1 persulfide intermediate to ISCU and small thiols like L-cysteine and glutathione, leading to persulfuration and eventual sulfide release. It binds ferrous ion and is released from FXN upon the addition of both L-cysteine and reduced FDX2 during [2Fe-2S] cluster assembly. This ISC assembly complex is integral to de novo synthesis of a [2Fe-2S] cluster, the initial step in mitochondrial iron-sulfur protein biogenesis. The process involves the cysteine desulfurase complex (NFS1:LYRM4:NDUFAB1), initiating persulfide production, and FXN-dependent delivery to ISCU. FDX2 stabilizes this complex, providing reducing equivalents for [2Fe-2S] cluster assembly. The cluster is subsequently transferred from ISCU to chaperone proteins, including HSCB, HSPA9, and GLRX5. FXN may play a role in protecting against iron-catalyzed oxidative stress by catalyzing the oxidation of Fe(2+) to Fe(3+), exhibiting ferroxidase activity in its oligomeric form. It potentially acts as an iron chaperone, safeguarding the aconitase [4Fe-4S]2+ cluster, promoting enzyme reactivation, and serving as a high-affinity iron binding partner for FECH, contributing to mitochondrial heme biosynthesis. FXN also modulates the RNA-binding activity of ACO1, may participate in cytoplasmic iron-sulfur protein biogenesis, and could contribute to oxidative stress resistance and overall cell survival.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

O35943 (L78-T207)

Gene ID
Molecular Construction
N-term
6*His
FXN (L78-T207)
Accession # O35943
C-term
Synonyms
FrdaFrataxin; mitochondrial; Fxn; EC 1.16.3.1; Frataxin intermediate form; Frataxin mature form
AA Sequence

LGTLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLARELTKALNTKLDLSSLAYSGKGT

Molecular Weight

Approximately 19.9 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FXN Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FXN Protein, Mouse (His)
Cat. No.:
HY-P72199
Quantity:
MCE Japan Authorized Agent: