1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. G-CSF
  5. G-CSF Protein, Human

G-CSF Protein, Human

Cat. No.: HY-P70422
SDS COA Handling Instructions

Granulocyte colony-stimulating factor (G-CSF) is a glycoprotein secreted by the cells of the immune system, fibroblasts and endothelium, which acts as a hematopoietic and endothelial precursor cells cytokine. G-CSF stimulates maturation of progenitor cells in the bone marrow into differentiated granulocytes, macrophages and the T cells. G-CSF also shows to convey neuroprotection to central neurons upon increases in phosphorylation of PI3K/Akt pathway and regulates epithelial to mesenchymal transition in cancer. G-CSF Protein (Human) is a recombinant protein with tag free that consists of 200 or 204 amino acids, which is expressed in E. coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg Get quote
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE G-CSF Protein, Human

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Granulocyte colony-stimulating factor (G-CSF) is a glycoprotein secreted by the cells of the immune system, fibroblasts and endothelium, which acts as a hematopoietic and endothelial precursor cells cytokine. G-CSF stimulates maturation of progenitor cells in the bone marrow into differentiated granulocytes, macrophages and the T cells. G-CSF also shows to convey neuroprotection to central neurons upon increases in phosphorylation of PI3K/Akt pathway and regulates epithelial to mesenchymal transition in cancer. G-CSF Protein (Human) is a recombinant protein with tag free that consists of 200 or 204 amino acids, which is expressed in E. coli[1][2][3][4][5][6][7][8].

Background

G-CSF Protein (Human) is a glycoprotein, acting to stimulate granulopoiesis, the innate immunity, and the differentiation of neural progenitor cells[1].
G-CSF Protein (Human) levels are associated with various cancers, such as lung cancer, glioma, colorectal cancers, bladder cancer, melanoma, skin carcinom, bone metastases in cancers of prostate and breast, , and more[1].
G-CSF Protein (Human) acts via a specific cognate receptor (G-CSFR) that belongs to the class I cytokine receptor superfamily, and then activates members of the Janus kinase family (JAK1, JAK2, and TYK2), cytoplasmic tyrosine kinases associated with Box 1. G-CSF Protein (Human) stimulates the proliferation, differentiation, and function of myeloid progenitors and mobilization of hematopoietic stem and progenitor cells, which shows potential application for skeletal muscle repair and regeneration[2].
G-CSF Protein (Human) induces hematopoietic stem/progenitor cell mobilisation and stimulates angiogenesisrelated endothelial cell proliferation and migration and has the potential to inhibit the progression of atherosclerosis in animal models[3].
G-CSF Protein (Human) expression is enhanced by activation of the RAS/MEK/ERK pathway through the Ets transcription factor and promotes resistance to anti-VEGF therapy[5].
G-CSF Protein (Human) promotes the viability and angiogenesis of injured liver via direct efects on the liver cells[8].

In Vitro

Incubation of alpha-smooth muscle actin (αSMA+)/CD105+/CD31- cells with FGFs induces G-CSF Protein (Human) release in a MEK-dependent manner[5].
G-CSF Protein (Human) (0.5, 1, 10 μg/mL, 0-96 h) directly promotes cell viability and VEGF-A expression in human injured liver cells[8].

In Vivo

G-CSF Protein (Human) improves recovery after muscle crush injury, significantly increasing muscle strength in male Wistar rats. G-CSF Protein (Human) also increases rates of regeneration and activation of anabolic signalling pathways, such as Akt in mice injected with snake venom to cause skeletal muscle necrosis[2].
G-CSF Protein (Human) (≤100 μg/kg, i.v. or s.c. or i.p., daily for 6,8,12 weeks) reduces the area of atherosclerotic lesions in rabbit and mouse models of atherosclerosis[3].
G-CSF Protein (Human) (5 μg/kg , infusion, a sinfle dose at 4 h and 24 h) induces a 3-4 fold spike in circulating endothelial progenitor cells (CEPs) levels, similar to that using OXi-4503 (HY-16147) in non tumor bearing BALB/c and C57Bl/6 mice[4].
G-CSF Protein (Human) plasma levels are substantially elevated after treated with OXi-4503 (HY-16147) (100 mg/kg, i.p., a single dose for 4 h) in G-CSF-R−/− mice bearing subcutaneous Lewis Lung Carcinoma (LLC) transplants[4].
G-CSF Protein (Human)--mediated resistance to antivascular endothelial growth factor (VEGF) therapies occurs through activation of RAS/MEK/ERK pathways and an Ets-induced overexpression of G-CSF Protein (Human) in murine models of pancreatic adenocarcinoma expressing RAS oncogene[5].
G-CSF Protein (Human) (250 µg/kg, s.c., a single dose) relieves liver injury and shows positive correlation with viability and angiogenesis in the injured liver in the injured liver mouse model[8].

Biological Activity

The ED50 is <0.1 ng/mL as measured by M-NFS-60 cells, corresponding to a specific activity of >1.0 × 107 units/mg.

  • Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 10.17 pg/mL, corresponding to a specific activity is 9.83×107 units/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q8N4W3 (T27-P200)/P09919-2 (T31-P204)

Gene ID
Molecular Construction
N-term
G-CSF (T31-P204)
Accession # P09919-2
C-term
Synonyms
Granulocyte Colony-Stimulating Factor; G-CSF; Pluripoietin; Filgrastim; Lenograstim; CSF3; C17orf33; GCSF
AA Sequence

TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Molecular Weight

Approximately 16-18 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 10 mM HAc-NaAc, 150 mM NaCl, 0.004% Tween 80, 5% Mannitol, pH 4.0 or 20 mM PB, 150 mM NaCl, pH 7.4 or 25 mM Tris, pH 8.0 or 10mM HAc-NaAc, 150 mM NaCl, pH 4.0 or 10mM HAc-NaAc, 150 mM NaCl, pH 4.0, 10% trehalose, 0.02% Tween80 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

G-CSF Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
G-CSF Protein, Human
Cat. No.:
HY-P70422
Quantity:
MCE Japan Authorized Agent: