GABARAP Protein, Human (GST)

GABARAP (gamma-aminobutyric acid receptor-associated protein) is a protein that performs multiple functions within cells. As a ubiquitin-like modifier, it participates in the intracellular transport of GABA(A) receptors and interacts with the cytoskeleton. GABARAP Protein, Human (GST) is the recombinant human-derived GABARAP protein, expressed by E. coli , with N-GST labeled tag. The total length of GABARAP Protein, Human (GST) is 117 a.a., with molecular weight of ~37.0 kDa.

GABARAP (Gamma-aminobutyric acid receptor-associated protein) is a protein that serves multiple functions within the cell. It acts as a ubiquitin-like modifier, participating in the intracellular transport of GABA(A) receptors and interacting with the cytoskeleton. GABARAP is involved in autophagy, specifically in the later stages of autophagosome maturation. It interacts with the reticulophagy receptor TEX264 to remodel subdomains of the endoplasmic reticulum into autophagosomes, which then merge with lysosomes for turnover of the endoplasmic reticulum. GABARAP is also essential for the local activation of the CUL3(KBTBD6/7) E3 ubiquitin ligase complex, which regulates the ubiquitination and degradation of TIAM1, a guanyl-nucleotide exchange factor. This degradation of TIAM1 affects downstream signal transduction pathways involved in cell migration, proliferation, and cytoskeleton organization. Additionally, GABARAP has been implicated in apoptosis. Overall, GABARAP plays a vital role in various biological processes, including intracellular transport, autophagy, cytoskeleton organization, and cell signaling.

Human

E. coli

N-GST

Q6IAW1 (M1-L117)

11337  [NCBI]

MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL

Approximately 37.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.