GABARAPL2/GATE-16 Protein, Human (His)

GABARAPL2/GATE-16 is an important ubiquitin-like modifier that complexly regulates intra-Golgi flux by coupling NSF activity with SNARE activation. It stimulates the ATPase activity of NSF and promotes binding to GOSR1. GABARAPL2/GATE-16 Protein, Human (His) is the recombinant human-derived GABARAPL2/GATE-16 protein, expressed by E. coli , with N-6*His labeled tag. The total length of GABARAPL2/GATE-16 Protein, Human (His) is 117 a.a., with molecular weight of ~15 KDa.

GABARAPL2/GATE-16, a ubiquitin-like modifier, intricately participates in intra-Golgi traffic, modulating transport through the coupling of NSF activity and SNAREs activation. It stimulates the ATPase activity of NSF, facilitating its association with GOSR1. Beyond its Golgi-related functions, GABARAPL2/GATE-16 plays a crucial role in autophagy, contributing to mitochondrial quality control by engaging in mitophagy. Unlike LC3s involved in phagophore membrane elongation, the GABARAP/GATE-16 subfamily assumes a pivotal role in the later stages of autophagosome maturation. Operating as a monomer, GABARAPL2/GATE-16 establishes a network of interactions with key autophagy-related proteins such as ATG3, ATG7, ATG13, ULK1, TP53INP1, TP53INP2, TBC1D25, SQSTM1, BNIP3, TECPR2, PCM1, TBC1D5, TRIM5, MEFV, TRIM21, WDFY3, UBA5, GOSR1, KBTBD6, KBTBD7, and others. These interactions emphasize its versatile role in cellular processes, ranging from Golgi dynamics to autophagy and reticulophagy regulation.

Human

E. coli

N-6*His

P60520 (M1-F117)

11345  [NCBI]

MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF

Approximately 15 kDa.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from sterile 50 mM Tris, 300 mM NaCl, pH 7.4, 5% trehalose,5% mannitol and 0.01% Tween80 .

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.