GADD45B Protein, Human (His)

GADD45B Protein, a pivotal mediator, regulates growth and apoptosis by activating the MTK1/MEKK4 MAPKKK signaling pathway. Interacting with GADD45GIP1, it forms a complex that modulates cellular responses under stress. Its central role in growth and apoptosis underscores its significance in orchestrating cellular processes, positioning GADD45B as a key player in the intricate network of signaling pathways governing cell fate decisions. GADD45B Protein, Human (His) is the recombinant human-derived GADD45B protein, expressed by E. coli , with N-6*His labeled tag. The total length of GADD45B Protein, Human (His) is 160 a.a., with molecular weight of ~24.0 kDa.

The GADD45B Protein plays a crucial role in the regulation of both growth and apoptosis, acting as a mediator in the activation of the stress-responsive MTK1/MEKK4 MAPKKK signaling pathway. Through its interactions, GADD45B associates with GADD45GIP1, forming a molecular complex that may contribute to the modulation of cellular responses under stress conditions. The involvement of GADD45B in growth regulation and apoptosis underscores its significance in orchestrating cellular processes in response to various stress stimuli, making it a key player in the intricate network of signaling pathways that govern cell fate decisions.

Human

E. coli

N-6*His

O75293 (M1-R160)

4616  [NCBI]

MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER

Approximately 19 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.