1. Recombinant Proteins
  2. Others
  3. Galectin-3/LGALS3 Protein, Human

Galectin-3/LGALS3 Protein is a type of galactoside-binding lectin that has a high binding affinity for carbohydrates with β-galactoside linkages. Galectin-3/LGALS3 Protein interacts with glycosylated proteins to mediate intercellular interactions and adhesion to the extracellular matrix. Galectin-3/LGALS3 Protein plays various roles, including regulating signaling pathways such as Wnt/β-catenin, affecting cell proliferation and survival, modulating immune functions, and influencing tumor progression. Galectin-3/LGALS3 Protein, Human is a recombinant galectin-3/LGALS3 protein expressed in E. coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Galectin-3/LGALS3 Protein, Human Featured Recommendations:

Top Publications Citing Use of Products

Publications Citing Use of MCE Galectin-3/LGALS3 Protein, Human

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Galectin-3/LGALS3 Protein is a type of galactoside-binding lectin that has a high binding affinity for carbohydrates with β-galactoside linkages. Galectin-3/LGALS3 Protein interacts with glycosylated proteins to mediate intercellular interactions and adhesion to the extracellular matrix. Galectin-3/LGALS3 Protein plays various roles, including regulating signaling pathways such as Wnt/β-catenin, affecting cell proliferation and survival, modulating immune functions, and influencing tumor progression. Galectin-3/LGALS3 Protein, Human is a recombinant galectin-3/LGALS3 protein expressed in E. coli[1][2].

Background

Galectin-3/LGALS3 Protein is widely distributed in most tissues and is extensively expressed in specific tissues, with extracellular, membrane-bound, cytoplasmic, and nuclear localization[1].
The preferred ligand for Galectin-3/LGALS3 Protein is N-acetylglucosamine, which is also the only galectin that contains a conserved N domain and a single carbohydrate recognition domain (CRD). The N domain allows the formation of multimer complexes with proteins that do not bind to carbohydrate targets[1].
Galectin-3/LGALS3 Protein has a variety of cell functions, including regulating environment-sensitive cell adhesion or splitting, modulating clathrin-independent endocytosis, controlling intracellular signaling through interactions with membrane-bound signal complexes, regulating Wnt/β-catenin signaling, affecting the activity of transcription factors like TTF-1 and STAT, influencing mRNA maturation by affecting spliceosome function, repairing DNA damage, inducing late G1 cell cycle arrest, promoting cell proliferation, and enhancing cell survival through anti-apoptotic effects via Bcl2[1].
Galectin-3/LGALS3 Protein is involved in immune function. It enhances innate immunity by cleaning up cellular debris, promoting the production of respiratory burst enzymes, serving as a specific phagocytic signal for MerTK, and acting as a warning signal in the central nervous system; additionally, it can promote adaptive immunity by regulating T cell activation[2].
Galectin-3/LGALS3 Protein is closely related to pathological processes such as tumors, cardiovascular diseases, and acute kidney injury[3][4][5].

In Vitro

High expression of Galectin-3/LGALS3 Protein in MI D1 macrophages can promote neutrophil degranulation and regulate myocardial infarction[3].
Overexpression of Galectin-3/LGALS3 Protein in non-small cell lung cancer may be associated with the occurrence and development of lung cancer[4].
The lack of expression of Galectin-3/LGALS3 Protein in DCT cells of LGALS3 gene knockdown mice can promote AGE-mediated cell apoptosis[5].
The lack of expression of Galectin-3/LGALS3 Protein in metastatic melanoma cells where the LGALS3 gene is silenced can inhibit the expression of the pro-tumor gene autotaxin (ENPP2) and the transcription factor NFAT1[6].

In Vivo

The lack of expression of the Galectin-3/LGALS3 Protein in LGALS3 mutant (LGALS3 -/-) mice leads to a more diverse circadian rhythm pattern in their eating, drinking, and exercise behaviors[1].
The expression level of Galectin-3/LGALS3 Protein is elevated in mice with acute kidney injury caused by rhabdomyolysis (RIAKI), thereby providing protection to the distal nephron from damage mediated by AGEs[5].
Galectin-3/LGALS3 Protein is not expressed in melanoma mice with silenced LGALS3 gene, thereby promoting melanoma growth and metastasis by inhibiting the expression of NFAT1 and autotaxin[6].

Biological Activity

Measured by the ability of the immobilized protein to support the adhesion of MOLT-4 human acute lymphoblastic leukemia cells. The ED50 for this effect is 2.109 μg/mL.

  • Measured by its ability to induce IL-8 secretion in HT1080 human fibrosarcoma cells transfected with human OX40/TNFRSF4. The ED50 for this effect is 3.527ng/mL, corresponding to a specific activity is 2.836×105 U/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P17931 (A2-I250)

Gene ID
Molecular Construction
N-term
LGALS3 (A2-I250)
Accession # P17931
C-term
Synonyms
rHuGalectin-3; Galectin-3; Gal-3; 35 kDa Lectin; Carbohydrate-Binding Protein 35; CBP 35; Galactose-Specific Lectin 3; Galactoside-Binding Protein; GALBP; IgE-Binding Protein; L-31; Laminin-Binding Protein; Lectin L-29; Mac-2 Antigen; LGALS3; MAC2
AA Sequence

ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

Molecular Weight

Approximately 29 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM HEPES, 5% Sucrose, 5% Mannitol, 0.06% Tween80, pH 7.5 or PBS, pH 7.4, 8% trehalose or 50 mM HEPES, 150 mMNaC1, 5% Treha1ose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Galectin-3/LGALS3 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Galectin-3/LGALS3 Protein, Human
Cat. No.:
HY-P70309
Quantity:
MCE Japan Authorized Agent: