1. Recombinant Proteins
  2. Others
  3. Galectin-3/LGALS3 Protein, Mouse (HEK293, His)

Galectin-3/LGALS3 Protein, Mouse (HEK293, His)

Cat. No.: HY-P77684
SDS COA Handling Instructions

Galectin-3/LGALS3 protein binds IgE and cooperates with integrins α-3 and β-1 to promote endothelial cell migration.It contributes to epithelial cell differentiation and acts as a splicing factor in the nucleus.Galectin-3/LGALS3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Galectin-3/LGALS3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $70 In-stock
10 μg $110 In-stock
20 μg $178 In-stock
50 μg $300 In-stock
100 μg $510 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Galectin-3/LGALS3 protein binds IgE and cooperates with integrins α-3 and β-1 to promote endothelial cell migration.It contributes to epithelial cell differentiation and acts as a splicing factor in the nucleus.Galectin-3/LGALS3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Galectin-3/LGALS3 protein, expressed by HEK293 , with C-His labeled tag.

Background

Galectin-3 (LGALS3) functions as a galactose-specific lectin with the ability to bind IgE and, in collaboration with the alpha-3, beta-1 integrin, participates in the CSPG4-induced stimulation of endothelial cell migration. Alongside DMBT1, it is essential for the terminal differentiation of columnar epithelial cells during early embryogenesis. In the nucleus, Galectin-3 acts as a pre-mRNA splicing factor. Outside the nucleus, it plays a crucial role in acute inflammatory responses, involving neutrophil activation and adhesion, monocyte macrophage chemoattraction, opsonization of apoptotic neutrophils, and mast cell activation. Furthermore, in coordination with TRIM16, Galectin-3 facilitates the recognition of membrane damage, mobilizing core autophagy regulators ATG16L1 and BECN1 in response to damaged endomembranes. The protein likely forms homo- or heterodimers and interacts with various partners, including DMBT1, CD6, ALCAM, ITGA3, ITGB1, CSPG4, LGALS3BP, LYPD3, ZFTRAF1, and UACA, with the interaction with TRIM16 mediating the autophagy of damaged endomembranes.

Biological Activity

Measured by the ability of the immobilized protein to support the adhesion of CTLL-2 cells. The ED50 for this effect is 1.044 μg/mL, corresponding to a specific activity is 957.854 units/mg.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

P16110 (A2-I264)

Gene ID
Molecular Construction
N-term
LGALS3 (A2-I264)
Accession # P16110
His
C-term
Synonyms
AGE-R3; CBP35; GAL3; Gal-3; galactin-3; GALBPCBP35; Galectin3; GALIG; L29; L31; Lectin L-29; LGALS2; LGALS3; Mac-2; MAC2GAL3
AA Sequence

ADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGQPAPGAFPGQPGAPGAYPQCSGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI

Molecular Weight

Approximately 35-50 kDa

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 300 mM L-Arginine, pH 7.4 or 50 mM HEPES, 150 mM NaCl, 5 mM EDTA, 2 mM TCEP, pH 7.4 or PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Galectin-3/LGALS3 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Galectin-3/LGALS3 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P77684
Quantity:
MCE Japan Authorized Agent: