1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. GFER Protein, Rat (His-SUMO)

The GFER protein is a FAD-dependent sulfhydryl oxidase that restores redox-active disulfide bonds in CHCHD4/MIA40, an important partner for protein folding in the mitochondrial intermembrane space.GFER Protein, Rat (His-SUMO) is the recombinant rat-derived GFER protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GFER protein is a FAD-dependent sulfhydryl oxidase that restores redox-active disulfide bonds in CHCHD4/MIA40, an important partner for protein folding in the mitochondrial intermembrane space.GFER Protein, Rat (His-SUMO) is the recombinant rat-derived GFER protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

Background

GFER, a flavin adenine dinucleotide (FAD)-dependent sulfhydryl oxidase, serves as a crucial enzyme in the mitochondrial intermembrane space by facilitating the regeneration of redox-active disulfide bonds in CHCHD4/MIA40, a chaperone essential for disulfide bond formation and protein folding. The intricacy of this process involves the reduced form of CHCHD4/MIA40 transiently forming an intermolecular disulfide bridge with GFER/ERV1. This interaction results in the replenishment of essential disulfide bonds in CHCHD4/MIA40, while GFER/ERV1 undergoes re-oxidization by donating electrons to cytochrome c or molecular oxygen. Beyond its role in redox regulation, GFER may play a functional role in liver regeneration and spermatogenesis, further highlighting its significance in cellular processes beyond mitochondrial protein folding.

Species

Rat

Source

E. coli

Tag

N-His;N-SUMO

Accession

Q63042 (M1-D198)

Gene ID
Molecular Construction
N-term
6*His-SUMO
GFER (M1-D198)
Accession # Q63042
C-term
Synonyms
Gfer; AlrFAD-linked sulfhydryl oxidase ALR; EC 1.8.3.2; Augmenter of liver regeneration
AA Sequence

MAAPSEPAGFPRGSRFSFLPGGAHSEMTDDLVTDARGRGARHRKDNAPAAAPAPKGLEHGKRPCRACVDFKSWMRTQQKRDIKFREDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD

Molecular Weight

Approximately 38.8 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

GFER Protein, Rat (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GFER Protein, Rat (His-SUMO)
Cat. No.:
HY-P71571
Quantity:
MCE Japan Authorized Agent: