GFRA2/GDNFR-alpha-2 Protein, Mouse (HEK293, His)

GFRA2/GDNFR-α-2 protein acts as a receptor for neurotrophic factors and promotes NRTN-induced autophosphorylation and RET receptor activation. It also mediates GDNF signaling through the RET tyrosine kinase receptor. GFRA2/GDNFR-alpha-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived GFRA2/GDNFR-alpha-2 protein, expressed by HEK293 , with C-His labeled tag.

GFRA2/GDNFR-alpha-2 Protein serves as the receptor for neurturin, facilitating the NRTN-induced autophosphorylation and activation of the RET receptor. Additionally, it plays a role in mediating GDNF signaling through the RET tyrosine kinase receptor. Notably, GFRA2/GDNFR-alpha-2 is involved in the NRTN-induced phosphorylation of STAT3 at 'Ser-727,' highlighting its participation in signaling pathways associated with cell responses. These interactions underscore the significance of GFRA2 in transducing signals that regulate cellular processes and contribute to the intricate network of signaling events involved in neuronal development and maintenance.

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse Neurturin at 1 μg/mL binds Recombinant Mouse GFR alpha-2/GDNF R alpha-2. The ED₅₀ for this effect is 3.307 nM.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse Neurturin at 1 μg/mL binds Recombinant Mouse GFR alpha-2/GDNF R alpha-2 .The ED₅₀ for this effect is 3.307 nM.

Mouse

HEK293

C-10*His

O08842-1/NP_032141.2 (S22-S441)

14586  [NCBI]

SPSSPQGSELHGWRPQVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRSLCRTDHLCRSRLADFHANCRASYRTITSCPADNYQACLGSYAGMIGFDMTPNYVDSNPTGIVVSPWCNCRGSGNMEEECEKFLKDFTENPCLRNAIQAFGNGTDVNMSPKGPTFSATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSIQEQGLKANNSKELSMCFTELTTNISPGSKKVIKLYS

Approximately 70-80 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.