1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. GDNF family
  5. GFR alpha-2
  6. GFRA2/GDNFR-alpha-2 Protein, Human (HEK293, His)

GFRA2/GDNFR-alpha-2 Protein, Human (HEK293, His)

Cat. No.: HY-P70192
Handling Instructions Technical Support

GFRA2, also known as GDNFR-α-2, acts as a receptor for neurotrophic factor (NRTN) and promotes NRTN-induced autophosphorylation and RET receptor activation. In addition to neurotrophic factor signaling, GFRA2 can also mediate GDNF signaling through the RET tyrosine kinase. GFRA2/GDNFR-alpha-2 Protein, Human (HEK293, His) is the recombinant human-derived GFRA2/GDNFR-alpha-2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GFRA2, also known as GDNFR-α-2, acts as a receptor for neurotrophic factor (NRTN) and promotes NRTN-induced autophosphorylation and RET receptor activation. In addition to neurotrophic factor signaling, GFRA2 can also mediate GDNF signaling through the RET tyrosine kinase. GFRA2/GDNFR-alpha-2 Protein, Human (HEK293, His) is the recombinant human-derived GFRA2/GDNFR-alpha-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

GFRA2, also known as GDNFR-alpha-2, serves as a receptor for neurturin (NRTN), facilitating the NRTN-induced autophosphorylation and activation of the RET receptor. In addition to its role in neurturin signaling, GFRA2 exhibits the capability to mediate GDNF signaling through the RET tyrosine kinase receptor. Notably, GFRA2 plays a role in the NRTN-induced phosphorylation of STAT3 at 'Ser-727,' highlighting its involvement in the activation of downstream signaling pathways. This multifaceted receptor thus contributes to the intricate cellular responses orchestrated by neurturin and GDNF through the RET receptor.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O00451-1 (S22-S441)

Gene ID
Molecular Construction
N-term
GFRA2 (S22-S441)
Accession # O00451-1
6*His
C-term
Synonyms
rHuGDNF family receptor alpha-2/GFRA2, His ; GDNF Family Receptor Alpha-2; GDNF Receptor Alpha-2; GDNFR-Alpha-2; GFR-Alpha-2; GDNF Receptor Beta; GDNFR-Beta; Neurturin Receptor Alpha; NRTNR-Alpha; NTNR-Alpha; RET Ligand 2; TGF-Beta-Related Neurotrophic Factor Receptor 2; GFRA2; GDNFRB; RETL2; TRNR2
AA Sequence

SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNS

Molecular Weight

Approximately 80.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GFRA2/GDNFR-alpha-2 Protein, Human (HEK293, His)
Cat. No.:
HY-P70192
Quantity:
MCE Japan Authorized Agent: