GH/Somatotropin Protein, Human (CHO)

GH Protein, Human (CHO) is a peptide hormone that stimulates growth, cell reproduction, and cell regeneration, which can be used for the treatment of growth disorders in children.

Recombinant Human Growth Hormone is a peptide hormone that stimulates growth, cell reproduction, and cell regeneration, which can be used for the treatment of growth disorders in children^[1]. Growth Hormone is a stress hormone that stimulates production of IGF-1 and raises the concentration of glucose and free fatty acids^[2]. Growth Hormone exerts some of its effects by binding to receptors on target cells, where it activates the MAPK/ERK pathway^[3].

1. The ED₅₀ is <0.5 ng/mL as measured by murine Balb/c 3T3 cells, corresponding to a specific activity of >2 × 10⁶ units/mg.
2. ED₅₀ is < 0.5 ng/mL, as measured by a cell proliferation assay using Nb2-11 cells, corresponding to a specific activity of > 2.0 × 10⁶ units/mg

Human

CHO

Tag Free

CAA23779.1 (F27-F217)

2688  [NCBI]

FPTIPLSRLFDNASLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

20-24 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Takeda A, et al. Recombinant human growth hormone for the treatment of growth disorders in children: a systematic review and economic evaluation. Health Technol Assess. 2010 Sep;14(42):1-209, iii-iv.  [Content Brief]

  [2]. Ranabir S, et al. Stress and hormones. Indian J Endocrinol Metab. 2011 Jan;15(1):18-22.  [Content Brief]

  [3]. Binder G, et al. "Noonan Syndrome: Genetics and Responsiveness to Growth Hormone Therapy". Horm Res. 67 (Supplement 1): 45-49.