1. Recombinant Proteins
  2. Receptor Proteins
  3. Growth Hormone R/GHR Protein, Mouse (HEK293, Fc)

Growth Hormone R/GHR Protein, Mouse (HEK293, Fc)

Cat. No.: HY-P70850
Handling Instructions Technical Support

Growth Hormone R/GHR Protein, especially in its soluble form GHBP, acts as a plasma reservoir for growth hormone. GHBP not only regulates growth hormone availability but also potentially modulates or inhibits growth hormone signaling. This dual role highlights GHBP's regulatory impact on the intricate signaling pathways associated with growth hormone activity in the circulatory system. Growth Hormone R/GHR Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Growth Hormone R/GHR Protein, Mouse (HEK293, Fc) is 273 a.a., with molecular weight of 65-90 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Growth Hormone R/GHR Protein, especially in its soluble form GHBP, acts as a plasma reservoir for growth hormone. GHBP not only regulates growth hormone availability but also potentially modulates or inhibits growth hormone signaling. This dual role highlights GHBP's regulatory impact on the intricate signaling pathways associated with growth hormone activity in the circulatory system. Growth Hormone R/GHR Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Growth Hormone R/GHR Protein, Mouse (HEK293, Fc) is 273 a.a., with molecular weight of 65-90 kDa.

Background

The Growth Hormone R/GHR Protein, particularly in its soluble form known as GHBP, serves as a reservoir for growth hormone in plasma. This soluble variant has the additional role of potentially modulating or inhibiting growth hormone signaling. By acting as a reservoir, GHBP contributes to the regulation and availability of growth hormone in the circulatory system, and its modulatory or inhibitory function suggests a regulatory role in the complex signaling pathways associated with growth hormone activity.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q3UP14 (M1-Q273)

Gene ID
Molecular Construction
N-term
GHR (M1-Q273)
Accession # Q3UP14
hFc
C-term
Synonyms
growth hormone binding protein; growth hormone receptor; serum binding protein; Somatotropin receptor; GHR; GH receptor; GHBP
AA Sequence

MDLCQVFLTLALAVTSSTFSGSEATPATLGKASPVLQRINPSLGTSSSGKPRFTKCRSPELETFSCYWTEGDNPDLKTPGSIQLYYAKRESQRQAARIAHEWTQEWKECPDYVSAGKNSCYFNSSYTSIWIPYCIKLTTNGDLLDQKCFTVDEIVQPDPPIGLNWTLLNISLTGIRGDIQVSWQPPPNADVLKGWIILEYEIQYKEVNESKWKVMGPIWLTYCPVYSLRMDKEHEVRVRSRQRSFEKYSEFSEVLRVIFPQTNILEACEEDIQ

Molecular Weight

65-90 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Growth Hormone R/GHR Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Growth Hormone R/GHR Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P70850
Quantity:
MCE Japan Authorized Agent: