1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Gastric Inhibitory Peptide (GIP)
  5. GIP Protein, Mouse (HEK293, Fc)

GIP protein is a potent stimulator of insulin secretion that critically regulates glucose homeostasis by promoting insulin release from pancreatic beta cells. GIP has limited inhibitory effects on gastric acid secretion and plays dual roles in nutrient sensing and metabolic regulation, particularly in postprandial glucose metabolism. GIP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag. The total length of GIP Protein, Mouse (HEK293, Fc) is 64 a.a., with molecular weight of 40-45 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GIP protein is a potent stimulator of insulin secretion that critically regulates glucose homeostasis by promoting insulin release from pancreatic beta cells. GIP has limited inhibitory effects on gastric acid secretion and plays dual roles in nutrient sensing and metabolic regulation, particularly in postprandial glucose metabolism. GIP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag. The total length of GIP Protein, Mouse (HEK293, Fc) is 64 a.a., with molecular weight of 40-45 kDa.

Background

GIP Protein emerges as a potent stimulator of insulin secretion, playing a crucial role in glucose homeostasis. Its primary function lies in promoting the release of insulin from pancreatic beta cells, contributing to the regulation of blood glucose levels. In contrast, GIP demonstrates a relatively limited inhibitory effect on gastric acid secretion. This dual role positions GIP as a key player in the intricate interplay between nutrient sensing and metabolic regulation, particularly in the context of postprandial glucose metabolism. The protein's ability to enhance insulin secretion underscores its significance in the control of glucose metabolism, making it a target of interest in understanding and potentially modulating metabolic processes associated with diabetes and insulin resistance.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

P48756 (E22-Q85)

Gene ID
Molecular Construction
N-term
GIP (E22-Q85)
Accession # P48756
hFc
C-term
Synonyms
GIP; Incretin
AA Sequence

EKEEVEFRSHAKFAGPRPRGPRYAEGTFISDYSIAMDKIRQQDFVNWLLAQRGKKSDWKHNITQ

Molecular Weight

Predicted MW is 34.3 kDa. Due to glycosylation, the protein migrates to 40-45 kDa based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% Trehalose is added as protectant before Lyophilized

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GIP Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P77949
Quantity:
MCE Japan Authorized Agent: