Glia maturation factor beta/GMFB Protein, Human (His)

Glial maturation factor beta (GMFB) protein serves as a key regulator that promotes brain cell differentiation, stimulates nerve regeneration and inhibits tumor cell proliferation. Phosphorylation, particularly that induced by phorbol esters, enhances its activity, suggesting a finely regulated mechanism in response to external signals. Glia maturation factor beta/GMFB Protein, Human (His) is the recombinant human-derived Glia maturation factor beta/GMFB protein, expressed by E. coli , with C-6*His labeled tag. The total length of Glia maturation factor beta/GMFB Protein, Human (His) is 142 a.a., with molecular weight of ~18.0 kDa.

Glia maturation factor beta (GMFB) protein emerges as a key regulator in diverse cellular processes, promoting the differentiation of brain cells, stimulating neural regeneration, and concurrently inhibiting the proliferation of tumor cells. This multifunctional protein undergoes phosphorylation, a modification that enhances its activity and is notably stimulated by phorbol ester. The phosphorylated state of GMFB suggests a regulatory mechanism that fine-tunes its functions in response to external signals, potentially playing a crucial role in cellular signaling cascades. The dual capacity of GMFB to influence both neural development and tumor cell proliferation highlights its versatile and intricate involvement in fundamental biological processes, suggesting its potential as a significant player in the modulation of cellular fate and function.

Human

E. coli

C-6*His

P60983 (M1-H142)

2764  [NCBI]

MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH

Approximately 18.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.