1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. Glia maturation factor beta/GMFB Protein, Human (His)

Glia maturation factor beta/GMFB Protein, Human (His)

Cat. No.: HY-P70387
Handling Instructions Technical Support

Glial maturation factor beta (GMFB) protein serves as a key regulator that promotes brain cell differentiation, stimulates nerve regeneration and inhibits tumor cell proliferation. Phosphorylation, particularly that induced by phorbol esters, enhances its activity, suggesting a finely regulated mechanism in response to external signals. Glia maturation factor beta/GMFB Protein, Human (His) is the recombinant human-derived Glia maturation factor beta/GMFB protein, expressed by E. coli , with C-6*His labeled tag. The total length of Glia maturation factor beta/GMFB Protein, Human (His) is 142 a.a., with molecular weight of ~18.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Glial maturation factor beta (GMFB) protein serves as a key regulator that promotes brain cell differentiation, stimulates nerve regeneration and inhibits tumor cell proliferation. Phosphorylation, particularly that induced by phorbol esters, enhances its activity, suggesting a finely regulated mechanism in response to external signals. Glia maturation factor beta/GMFB Protein, Human (His) is the recombinant human-derived Glia maturation factor beta/GMFB protein, expressed by E. coli , with C-6*His labeled tag. The total length of Glia maturation factor beta/GMFB Protein, Human (His) is 142 a.a., with molecular weight of ~18.0 kDa.

Background

Glia maturation factor beta (GMFB) protein emerges as a key regulator in diverse cellular processes, promoting the differentiation of brain cells, stimulating neural regeneration, and concurrently inhibiting the proliferation of tumor cells. This multifunctional protein undergoes phosphorylation, a modification that enhances its activity and is notably stimulated by phorbol ester. The phosphorylated state of GMFB suggests a regulatory mechanism that fine-tunes its functions in response to external signals, potentially playing a crucial role in cellular signaling cascades. The dual capacity of GMFB to influence both neural development and tumor cell proliferation highlights its versatile and intricate involvement in fundamental biological processes, suggesting its potential as a significant player in the modulation of cellular fate and function.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P60983 (M1-H142)

Gene ID
Molecular Construction
N-term
GMFB (M1-H142)
Accession # P60983
6*His
C-term
Synonyms
rHuGlia maturation factor beta/GMF-beta, His; Glia maturation factor beta; GMF-beta; GMFB
AA Sequence

MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH

Molecular Weight

Approximately 18.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Glia maturation factor beta/GMFB Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Glia maturation factor beta/GMFB Protein, Human (His)
Cat. No.:
HY-P70387
Quantity:
MCE Japan Authorized Agent: