1. Recombinant Proteins
  2. Receptor Proteins
  3. G-Protein-Coupled Receptors (GPCRs)
  4. Glucagon Receptor
  5. GLP-1 Receptor
  6. GLP1R Protein, Human (HEK293, N-His, C-Myc)

The GLP1R protein is a G protein-coupled receptor for glucagon-like peptide 1 (GLP-1), which upon ligand binding activates adenylyl cyclase and increases cAMP levels. This interaction critically regulates insulin secretion, affecting cellular responses and metabolic processes associated with GLP-1 signaling. GLP1R Protein, Human (HEK293, N-His, C-Myc) is the recombinant human-derived GLP1R protein, expressed by HEK293 , with C-Myc, N-10*His labeled tag. The total length of GLP1R Protein, Human (HEK293, N-His, C-Myc) is 122 a.a., with molecular weight of 33 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GLP1R protein is a G protein-coupled receptor for glucagon-like peptide 1 (GLP-1), which upon ligand binding activates adenylyl cyclase and increases cAMP levels. This interaction critically regulates insulin secretion, affecting cellular responses and metabolic processes associated with GLP-1 signaling. GLP1R Protein, Human (HEK293, N-His, C-Myc) is the recombinant human-derived GLP1R protein, expressed by HEK293 , with C-Myc, N-10*His labeled tag. The total length of GLP1R Protein, Human (HEK293, N-His, C-Myc) is 122 a.a., with molecular weight of 33 kDa.

Background

The GLP1R Protein functions as a G-protein coupled receptor for glucagon-like peptide 1 (GLP-1), participating in a signaling cascade upon ligand binding that activates adenylyl cyclase and increases intracellular cAMP levels. This molecular interaction plays a crucial role in regulating insulin secretion in response to GLP-1. The receptor's activation contributes to the modulation of cellular responses and metabolic processes associated with GLP-1 signaling. Notably, the allosteric modulators NNC0640, PF-06372222, and MK-0893 demonstrate inhibitory effects on the increase of intracellular cAMP levels in response to GLP-1, offering potential avenues for pharmacological intervention in this signaling pathway.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human GLP1R at 2 μg/mL can bind Anti-GLP1R recombinant antibody, the EC50 is ≤95 ng/mL.

Species

Human

Source

HEK293

Tag

C-Myc;N-10*His

Accession

P43220 (R24-Y145)

Gene ID
Molecular Construction
N-term
10*His
GLP1R (R24-Y145)
Accession # P43220
C-term
Synonyms
rHuGlucagon-like peptide 1 receptor/GLP1R, Fc; Glucagon-like peptide 1 receptor; GLP-1 receptor; GLP-1-R
AA Sequence

RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY

Molecular Weight

33 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GLP1R Protein, Human (HEK293, N-His, C-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GLP1R Protein, Human (HEK293, N-His, C-Myc)
Cat. No.:
HY-P700468
Quantity:
MCE Japan Authorized Agent: