Glutamine synthetase/GLUL Protein, Human (His)

GLUL proteins catalyze the conversion of glutamate and ammonia to glutamine. Glutamine synthetase/GLUL Protein, Human (His) is the recombinant human-derived Glutamine synthetase/GLUL protein, expressed by E. coli , with C-6*His labeled tag. The total length of Glutamine synthetase/GLUL Protein, Human (His) is 372 a.a., with molecular weight of 40-50 kDa.

Glutamine synthetase/GLUL Protein serves as a crucial enzyme catalyzing the ATP-dependent conversion of glutamate and ammonia to glutamine. Its functional significance varies with tissue localization; in the brain, it plays a pivotal role in regulating levels of toxic ammonia and converting neurotoxic glutamate to harmless glutamine. Conversely, in the liver, GLUL is integral to the enzymatic machinery responsible for ammonia removal. Beyond its classical role in glutamine synthesis, GLUL exhibits diverse functions. It is essential for the proliferation of fetal skin fibroblasts and independently contributes to endothelial cell migration during vascular development by regulating membrane localization and activation of the GTPase RHOJ, potentially through promoting RHOJ palmitoylation. Furthermore, GLUL may act as a palmitoyltransferase for RHOJ, demonstrating autopalmitoylation capability and subsequent transfer of the palmitoyl group to RHOJ. Additionally, GLUL plays a role in ribosomal 40S subunit biogenesis. The multifaceted activities of GLUL underscore its importance in various cellular processes, highlighting its versatility in both metabolic and regulatory contexts.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

C-6*His

P15104 (T2-N373)

2752  [NCBI]

TTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN

40-50 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 200 mM NaCl, 50 mM Imidazole, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.