GMP PDGF-BB Protein, Human

The PDGF-BB protein is a key growth factor that centrally regulates embryonic development, cell proliferation, migration, survival, and chemotaxis. It is known for its potent mitogenic effects on mesenchymal cells and is essential for the normal proliferation and recruitment of pericytes and vascular smooth muscle cells in tissues such as the central nervous system, skin, lungs, heart, and placenta. GMP PDGF-BB Protein, Human is the recombinant human-derived PDGF-BB protein, expressed by E. coli , with tag free. The total length of GMP PDGF-BB Protein, Human is 109 a.a., with molecular weight of ~14.0 kDa.

GMP PDGF-BB Protein, a pivotal growth factor, assumes a central role in regulating embryonic development, cell proliferation, migration, survival, and chemotaxis. Renowned for its potent mitogenic effects on mesenchymal cells, GMP PDGF-BB is indispensable for the normal proliferation and recruitment of pericytes and vascular smooth muscle cells in various tissues, including the central nervous system, skin, lung, heart, and placenta. Its vital contributions extend to the development of blood vessels and kidney glomeruli, highlighting its significance in vascular and renal physiology. A key participant in wound healing, GMP PDGF-BB's signaling dynamics are finely tuned through heterodimer formation with PDGFA. Present as an antiparallel homodimer, GMP PDGF-BB engages in disulfide-linked interactions with PDGFRA and PDGFRB homodimers, as well as with heterodimers formed by PDGFRA and PDGFRB. Additionally, it forms antiparallel heterodimers with PDGFA, further diversifying its regulatory repertoire. Notably, GMP PDGF-BB establishes connections with XLKD1, LRP1, and SORL1, contributing to a network of interactions that modulate its multifaceted functions.

The specific activity is > 2.37×10⁴ IU/mg.

Human

E. coli

Tag Free

P01127 (S82-T190)

5155  [NCBI]

SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

Approximately 14.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM NaAc-HAc, pH 4.5.

<0.1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in injection water.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.