1. Recombinant Proteins
  2. Others
  3. GOLM1 Protein, Human (HEK293, His)

GOLM1 Protein, amid partial comprehension, acts as a cellular response protein to viral infections, with an intricate role yet to be fully understood. Interactions with DYM suggest potential links to cellular dynamics or host-virus interactions. Further investigation is crucial to delineate GOLM1's specific contributions and implications in cellular defense mechanisms against viral infections. GOLM1 Protein, Human (HEK293, His) is the recombinant human-derived GOLM1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GOLM1 Protein, amid partial comprehension, acts as a cellular response protein to viral infections, with an intricate role yet to be fully understood. Interactions with DYM suggest potential links to cellular dynamics or host-virus interactions. Further investigation is crucial to delineate GOLM1's specific contributions and implications in cellular defense mechanisms against viral infections. GOLM1 Protein, Human (HEK293, His) is the recombinant human-derived GOLM1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

GOLM1, while not fully understood, emerges as a cellular response protein to viral infections. Its precise role in this context remains elusive, reflecting the complexity of its functions in cellular processes. Notably, GOLM1 engages in interactions with DYM, hinting at potential associations with pathways related to cellular dynamics or host-virus interactions. The intricate nature of GOLM1's involvement in viral responses underscores the need for further investigation to unravel its specific contributions and implications in the cellular defense mechanisms against viral infections.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q8NBJ4-1 (S36-L401)

Gene ID
Molecular Construction
N-term
GOLM1 (S36-L401)
Accession # Q8NBJ4-1
6*His
C-term
Synonyms
Golgi Membrane Protein 1; Golgi Membrane Protein GP73; Golgi Phosphoprotein 2; GOLM1; C9orf155; GOLPH2
AA Sequence

SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL

Molecular Weight

Approximately 66.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

GOLM1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GOLM1 Protein, Human (HEK293, His)
Cat. No.:
HY-P70879
Quantity:
MCE Japan Authorized Agent: