1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Glycoprotein Hormone alpha-2 (GPHA2)
  5. GPHA2 Protein, Human (HEK293, His)

GPHA2 acts as a heterodimeric glycoprotein hormone together with GPHB5 to form a complex that binds and activates the thyroid-stimulating hormone receptor (TSHR), thereby triggering elevated cAMP production. This protein complex plays a key role in the regulation of thyroid cell metabolism, controlling the basic metabolic processes of thyroid cells. GPHA2 Protein, Human (HEK293, His) is the recombinant human-derived GPHA2 protein, expressed by HEK293 , with C-His labeled tag. The total length of GPHA2 Protein, Human (HEK293, His) is 106 a.a., with molecular weight of ~23 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GPHA2 acts as a heterodimeric glycoprotein hormone together with GPHB5 to form a complex that binds and activates the thyroid-stimulating hormone receptor (TSHR), thereby triggering elevated cAMP production. This protein complex plays a key role in the regulation of thyroid cell metabolism, controlling the basic metabolic processes of thyroid cells. GPHA2 Protein, Human (HEK293, His) is the recombinant human-derived GPHA2 protein, expressed by HEK293 , with C-His labeled tag. The total length of GPHA2 Protein, Human (HEK293, His) is 106 a.a., with molecular weight of ~23 kDa.

Background

GPHA2 (Glycoprotein Hormone Alpha 2) functions as a crucial heterodimeric glycoprotein hormone alongside GPHB5, with the ability to bind and activate the thyroid-stimulating hormone receptor (TSHR), ultimately resulting in elevated cAMP production. This glycoprotein hormone complex plays a central role in the regulation of thyroid cell metabolism, indicating its significance in the control of thyroid function and hormonal balance. The functional partnership between GPHA2 and GPHB5 is highlighted by their formation of a heterodimer, and this complex specifically interacts with TSHR, thereby initiating the cascade leading to increased cAMP levels.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q96T91 (Q24-Y129)

Gene ID
Molecular Construction
N-term
GPHA2 (Q24-Y129)
Accession # Q96T91
His
C-term
Synonyms
Glycoprotein hormone alpha-2; Putative secreted protein Zsig51; GPA2; ZSIG51
AA Sequence

QEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY

Molecular Weight

Approximately 23 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GPHA2 Protein, Human (HEK293, His)
Cat. No.:
HY-P76958
Quantity:
MCE Japan Authorized Agent: