GPHA2 Protein, Human (HEK293, His)

GPHA2 acts as a heterodimeric glycoprotein hormone together with GPHB5 to form a complex that binds and activates the thyroid-stimulating hormone receptor (TSHR), thereby triggering elevated cAMP production. This protein complex plays a key role in the regulation of thyroid cell metabolism, controlling the basic metabolic processes of thyroid cells. GPHA2 Protein, Human (HEK293, His) is the recombinant human-derived GPHA2 protein, expressed by HEK293 , with C-His labeled tag. The total length of GPHA2 Protein, Human (HEK293, His) is 106 a.a., with molecular weight of ~23 kDa.

GPHA2 (Glycoprotein Hormone Alpha 2) functions as a crucial heterodimeric glycoprotein hormone alongside GPHB5, with the ability to bind and activate the thyroid-stimulating hormone receptor (TSHR), ultimately resulting in elevated cAMP production. This glycoprotein hormone complex plays a central role in the regulation of thyroid cell metabolism, indicating its significance in the control of thyroid function and hormonal balance. The functional partnership between GPHA2 and GPHB5 is highlighted by their formation of a heterodimer, and this complex specifically interacts with TSHR, thereby initiating the cascade leading to increased cAMP levels.

Human

HEK293

C-6*His

Q96T91 (Q24-Y129)

170589  [NCBI]

QEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY

Approximately 23 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.