GPR114 Protein, Human (HEK293, Fc)

GPR114, an adhesion G protein-coupled receptor (GPCR), crucially activates the adenylate cyclase pathway by coupling with G(s) subunit alpha. Isoform 1, displaying constitutive activity, elevates basal cyclic AMP (cAMP) levels and responds to mechanical stimulation, emphasizing GPR114's functional significance in intracellular signaling cascades and its role in cellular responses to mechanical cues. GPR114 Protein, Human (HEK293, Fc) is the recombinant human-derived GPR114 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of GPR114 Protein, Human (HEK293, Fc) is 163 a.a., with molecular weight of 57-75 kDa.

GPR114 is an adhesion G protein-coupled receptor (GPCR) that plays a key role in signal transduction by coupling with the G(s) subunit alpha of guanine nucleotide-binding proteins and activating the adenylate cyclase pathway. Notably, isoform 1 exhibits constitutive activity, leading to elevated basal levels of cyclic AMP (cAMP), and demonstrates responsiveness to mechanical stimulation, such as shaking. This highlights the functional significance of GPR114 in mediating intracellular signaling cascades and suggests its involvement in cellular responses to mechanical cues.

Measured by the ability of the immobilized protein to enhance the adhesion of U251 human glioblastoma cells to human Fibronectin. When 4 x 10⁴ cells/well are added to plates coated with human Fibronectin (0.1 µg/mL) and rhGPR114 (10µg/well, 100µL/well) for 45 minutes at 37 °C, there is a 2.1 fold increase in adhesion to human fibronectin induced by the presence of rhGPR114.

Human

HEK293

C-hFc

Q8IZF4 (E22-G184)

221188  [NCBI]

ETWEELLSYMENMQVSRGRSSVFSSRQLHQLEQMLLNTSFPGYNLTLQTPTIQSLAFKLSCDFSGLSLTSATLKRVPQAGGQHARGQHAMQFPAELTRDACKTRPRELRLICIYFSNTHFFKDENNSSLLNNYVLGAQLSHGHVNNLRDPVNISFWHNQSLEG

Approximately 57-75 kDa due to the glycosylation.

Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 10% trehalose, 0.02% Tween80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.