Group XV phospholipase A2/Pla2g15, Mouse (His, myc)

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-dependent phospholipase and O-acyltransferase activities that contribute to glycerophospholipid homeostasis and acyl remodeling in acidic cellular compartments. Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is the recombinant mouse-derived Group XV phospholipase A2/Pla2g15, expressed by E. coli , with N-His, C-Myc labeled tag. The total length of Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is 379 a.a., with molecular weight of ~50.5 kDa.

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-independent phospholipase and O-acyltransferase activities, potentially contributing to glycerophospholipid homeostasis and the remodeling of acyl groups in acidic cellular compartments. The enzyme catalyzes the hydrolysis of the ester bond of the fatty acyl group at sn-1 or sn-2 positions of phospholipids, demonstrating both phospholipase A1 and A2 activities, and transfers it to the hydroxyl group at the first carbon of lipophilic alcohols through O-acyltransferase activity. Pla2g15 prefers fatty acyl donors such as phosphatidylcholines, phosphatidylethanolamines, phosphatidylglycerols, and phosphatidylserines, favoring sn-2 over sn-1 deacylation of unsaturated fatty acyl groups. Additionally, it selectively hydrolyzes the sn-1 fatty acyl group of truncated oxidized phospholipids, potentially participating in the detoxification of reactive oxidized phospholipids during oxidative stress. Pla2g15 plays a vital role in phospholipid degradation in alveolar macrophages, suggesting implications in pulmonary surfactant clearance. At neutral pH, it hydrolyzes the sn-1 fatty acyl group of lysophosphatidylcholines.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Mouse

E. coli

N-His;C-Myc

Q8VEB4 (A34-P412)

192654  [NCBI]

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

Approximately 50.5 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution in PBS, pH 7.4.

<26 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.