1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Group XV phospholipase A2/Pla2g15, Mouse (His, myc)

Group XV phospholipase A2/Pla2g15, Mouse (His, myc)

Cat. No.: HY-P72293
SDS COA Handling Instructions Technical Support

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-dependent phospholipase and O-acyltransferase activities that contribute to glycerophospholipid homeostasis and acyl remodeling in acidic cellular compartments. Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is the recombinant mouse-derived Group XV phospholipase A2/Pla2g15, expressed by E. coli , with N-His, C-Myc labeled tag. The total length of Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is 379 a.a., with molecular weight of ~50.5 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-dependent phospholipase and O-acyltransferase activities that contribute to glycerophospholipid homeostasis and acyl remodeling in acidic cellular compartments. Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is the recombinant mouse-derived Group XV phospholipase A2/Pla2g15, expressed by E. coli , with N-His, C-Myc labeled tag. The total length of Group XV phospholipase A2/Pla2g15, Mouse (His, myc) is 379 a.a., with molecular weight of ~50.5 kDa.

Background

Group XV phospholipase A2 (Pla2g15) exhibits dual calcium-independent phospholipase and O-acyltransferase activities, potentially contributing to glycerophospholipid homeostasis and the remodeling of acyl groups in acidic cellular compartments. The enzyme catalyzes the hydrolysis of the ester bond of the fatty acyl group at sn-1 or sn-2 positions of phospholipids, demonstrating both phospholipase A1 and A2 activities, and transfers it to the hydroxyl group at the first carbon of lipophilic alcohols through O-acyltransferase activity. Pla2g15 prefers fatty acyl donors such as phosphatidylcholines, phosphatidylethanolamines, phosphatidylglycerols, and phosphatidylserines, favoring sn-2 over sn-1 deacylation of unsaturated fatty acyl groups. Additionally, it selectively hydrolyzes the sn-1 fatty acyl group of truncated oxidized phospholipids, potentially participating in the detoxification of reactive oxidized phospholipids during oxidative stress. Pla2g15 plays a vital role in phospholipid degradation in alveolar macrophages, suggesting implications in pulmonary surfactant clearance. At neutral pH, it hydrolyzes the sn-1 fatty acyl group of lysophosphatidylcholines.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Mouse

Source

E. coli

Tag

N-His;C-Myc

Accession

Q8VEB4 (A34-P412)

Gene ID
Molecular Construction
N-term
10*His
Pla2g15 (A34-P412)
Accession # Q8VEB4
C-term
Synonyms
Group XV phospholipase A2; 1-O-acylceramide synthase; ACS; LLPL; Lysosomal phospholipase A2
AA Sequence

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

Molecular Weight

Approximately 50.5 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution in PBS, pH 7.4.

Endotoxin Level

<26 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Group XV phospholipase A2/Pla2g15, Mouse (His, myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Group XV phospholipase A2/Pla2g15, Mouse (His, myc)
Cat. No.:
HY-P72293
Quantity:
MCE Japan Authorized Agent: