1. Recombinant Proteins
  2. Receptor Proteins
  3. Growth Hormone R/GHR Protein, Mouse (HEK293, His-Fc)

Growth Hormone R/GHR Protein, Mouse (HEK293, His-Fc)

Cat. No.: HY-P73086
Handling Instructions Technical Support

Growth hormone R/GHR protein, as a receptor for pituitary growth hormone, plays a crucial role in regulating postpartum body growth. Ligand binding activates the JAK2/STAT5 pathway, affecting downstream signaling in growth regulation. Growth Hormone R/GHR Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Growth hormone R/GHR protein, as a receptor for pituitary growth hormone, plays a crucial role in regulating postpartum body growth. Ligand binding activates the JAK2/STAT5 pathway, affecting downstream signaling in growth regulation. Growth Hormone R/GHR Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Background

Growth Hormone R/GHR Protein functions as the receptor for pituitary gland growth hormone, playing a crucial role in the regulation of postnatal body growth. Upon ligand binding, it couples to and activates the JAK2/STAT5 pathway, facilitating downstream signaling events involved in growth regulation. Notably, the soluble form of the receptor, known as GHBP, serves as a reservoir of growth hormone in plasma and exhibits the potential to modulate or inhibit GH signaling, thereby adding a layer of complexity to the finely tuned control of growth processes. The dual role of Growth Hormone R/GHR in mediating growth hormone actions and modulating its signaling highlights its significance in the intricate regulatory mechanisms governing postnatal growth.

Species

Mouse

Source

HEK293

Tag

C-hFc;C-His

Accession

P16882/NP_034414.2 (T25-Q273)

Gene ID
Molecular Construction
N-term
Growth Hormone R/GHR (T25-Q273)
Accession # P16882/NP_034414.2
hFc-His
C-term
Synonyms
Growth hormone receptor; GH receptor GHBP; Ghr
AA Sequence

MDLCQVFLTLALAVTSSTFSGSEATPATLGKASPVLQRINPSLGTSSSGKPRFTKCRSPELETFSCYWTEGDNPDLKTPGSIQLYYAKRESQRQAARIAHEWTQEWKECPDYVSAGKNSCYFNSSYTSIWIPYCIKLTTNGDLLDQKCFTVDEIVQPDPPIGLNWTLLNISLTGIRGDIQVSWQPPPNADVLKGWIILEYEIQYKEVNESKWKVMGPIWLTYCPVYSLRMDKEHEVRVRSRQRSFEKYSEFSEVLRVIFPQTNILEACEEDIQ

Molecular Weight

70-80 kDa

Purity

Greater than 85% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Growth Hormone R/GHR Protein, Mouse (HEK293, His-Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Growth Hormone R/GHR Protein, Mouse (HEK293, His-Fc)
Cat. No.:
HY-P73086
Quantity:
MCE Japan Authorized Agent: