1. Recombinant Proteins
  2. Receptor Proteins
  3. Growth Hormone R/GHR Protein, Mouse (HEK293, His)

Growth Hormone R/GHR Protein, Mouse (HEK293, His)

Cat. No.: HY-P73087
SDS COA Handling Instructions

Growth hormone R/GHR protein, as a receptor for pituitary growth hormone, plays a crucial role in regulating postpartum body growth. Ligand binding activates the JAK2/STAT5 pathway, affecting downstream signaling in growth regulation. Growth Hormone R/GHR Protein, Mouse (HEK293, His) is the recombinant mouse-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-His labeled tag. The total length of Growth Hormone R/GHR Protein, Mouse (HEK293, His) is 249 a.a., with molecular weight of 40-45 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Growth hormone R/GHR protein, as a receptor for pituitary growth hormone, plays a crucial role in regulating postpartum body growth. Ligand binding activates the JAK2/STAT5 pathway, affecting downstream signaling in growth regulation. Growth Hormone R/GHR Protein, Mouse (HEK293, His) is the recombinant mouse-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-His labeled tag. The total length of Growth Hormone R/GHR Protein, Mouse (HEK293, His) is 249 a.a., with molecular weight of 40-45 kDa.

Background

Growth Hormone R/GHR Protein functions as the receptor for pituitary gland growth hormone, playing a crucial role in the regulation of postnatal body growth. Upon ligand binding, it couples to and activates the JAK2/STAT5 pathway, facilitating downstream signaling events involved in growth regulation. Notably, the soluble form of the receptor, known as GHBP, serves as a reservoir of growth hormone in plasma and exhibits the potential to modulate or inhibit GH signaling, thereby adding a layer of complexity to the finely tuned control of growth processes. The dual role of Growth Hormone R/GHR in mediating growth hormone actions and modulating its signaling highlights its significance in the intricate regulatory mechanisms governing postnatal growth.

Biological Activity

Measured by its ability to inhibit GH-induced proliferation of Nb2-11 rat lymphoma cells. The ED50 of this effect is 1.455 ng/mL in the presence of 0.2 ng/mL GH, corresponding to a specific activity is 6.87×105 units/mg.

  • Measured by its ability to inhibit GH-induced proliferation of Nb2-11 rat lymphoma cells. The ED50 of this effect is 1.455 ng/mL in the presence of 0.2 ng/mL GH, corresponding to a specific activity is 6.87×105 units/mg.
Species

Mouse

Source

HEK293

Tag

C-His

Accession

P16882/NP_034414.2 (T25-Q273)

Gene ID
Molecular Construction
N-term
GHR (T25-Q273)
Accession # P16882
His
C-term
Synonyms
Growth hormone receptor; GH receptor GHBP; Ghr
AA Sequence

TPATLGKASPVLQRINPSLGTSSSGKPRFTKCRSPELETFSCYWTEGDNPDLKTPGSIQLYYAKRESQRQAARIAHEWTQEWKECPDYVSAGKNSCYFNSSYTSIWIPYCIKLTTNGDLLDQKCFTVDEIVQPDPPIGLNWTLLNISLTGIRGDIQVSWQPPPNADVLKGWIILEYEIQYKEVNESKWKVMGPIWLTYCPVYSLRMDKEHEVRVRSRQRSFEKYSEFSEVLRVIFPQTNILEACEEDIQ

Molecular Weight

40-45 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Growth Hormone R/GHR Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Growth Hormone R/GHR Protein, Mouse (HEK293, His)
Cat. No.:
HY-P73087
Quantity:
MCE Japan Authorized Agent: