Growth Hormone R/GHR Protein, Rat (HEK293, His)

Growth Hormone R/GHR Protein, a receptor for pituitary growth hormone, regulates postnatal body growth by activating the JAK2/STAT5 pathway upon ligand binding.Its soluble form, GHBP, acts as a plasma reservoir for growth hormone and potentially modulates or inhibits GH signaling.Growth Hormone R/GHR Protein, Rat (HEK293, His) is the recombinant rat-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-His labeled tag.

The Growth Hormone R (GHR) protein functions as a receptor for pituitary gland growth hormone, playing a crucial role in the regulation of postnatal body growth. Upon binding with its ligand, GHR couples to and activates the JAK2/STAT5 signaling pathway. Additionally, the soluble form of GHR, known as GHBP (Growth Hormone Binding Protein), serves as a reservoir for growth hormone in the plasma and may function as a modulator or inhibitor of growth hormone signaling. The dynamic interplay between GHR and growth hormone underscores its pivotal role in the intricate regulation of physiological processes related to body growth.

Measured by its ability to inhibit GH-induced proliferation of Nb2-11 rat lymphoma cells. The ED₅₀ of this effect is 0.5495 ng/mL in the presence of 0.2 ng/mL GH, corresponding to a specific activity is 1.8198×10⁶ units/mg.

Rat

HEK293

C-His

P16310-1 (F19-R265)

25235  [NCBI]

FPGSGATPATLGKASPVLQRINPSLRESSSGKPRFTKCRSPELETFSCYWTEGDDHNLKVPGSIQLYYARRIAHEWTPEWKECPDYVSAGANSCYFNSSYTSIWIPYCIKLTTNGDLLDEKCFTVDEIVQPDPPIGLNWTLLNISLPGIRGDIQVSWQPPPSADVLKGWIILEYEIQYKEVNETKWKTMSPIWSTSVPLYSLRLDKEHEVRVRSRQRSFEKYSEFSEVLRVTFPQMDTLAACEEDFR

35-45 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.