GSDMC Protein, Human (His-SUMO)

GSDMC protein serves as the precursor of pore-forming proteins and undergoes cleavage to release Gasdermin-C. This N-terminal moiety binds to the membrane, forming pores with an inner diameter of 10 to 15 nm and inducing pyroptosis. GSDMC Protein, Human (His-SUMO) is the recombinant human-derived GSDMC protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of GSDMC Protein, Human (His-SUMO) is 508 a.a., with molecular weight of ~73.7 kDa.

GSDMC protein serves as the precursor to the pore-forming protein, and upon cleavage, the released N-terminal moiety, known as Gasdermin-C, binds to membranes and forms pores, leading to the induction of pyroptosis. The pore-forming activity involves the homooligomerization of GSDMC within the membrane, resulting in the formation of pores with inner diameters ranging from 10 to 15 nanometers. This process is initiated by the cleavage of gasdermin-D by caspase CASP8 in response to death signals, and the subsequent movement of the cleaved protein to the plasma membrane, where it exhibits strong binding to the inner leaflet lipids, ultimately triggering pyroptosis.

Human

E. coli

N-SUMO;N-6*His

Q9BYG8 (M1-A508)

56169  [NCBI]

MPSMLERISKNLVKEIGSKDLTPVKYLLSATKLRQFVILRKKKDSRSSFWEQSDYVPVEFSLNDILEPSSSVLETVVTGPFHFSDIMIQKHKADMGVNVGIEVSVSGEASVDHGCSLEFQIVTIPSPNLEDFQKRKLLDPEPSFLKECRRRGDNLYVVTEAVELINNTVLYDSSSVNILGKIALWITYGKGQGQGESLRVKKKALTLQKGMVMAYKRKQLVIKEKAILISDDDEQRTFQDEYEISEMVGYCAARSEGLLPSFHTISPTLFNASSNDMKLKPELFLTQQFLSGHLPKYEQVHILPVGRIEEPFWQNFKHLQEEVFQKIKTLAQLSKDVQDVMFYSILAMLRDRGALQDLMNMLELDSSGHLDGPGGAILKKLQQDSNHAWFNPKDPILYLLEAIMVLSDFQHDLLACSMEKRILLQQQELVRSILEPNFRYPWSIPFTLKPELLAPLQSEGLAITYGLLEECGLRMELDNPRSTWDVEAKMPLSALYGTLSLLQQLAEA

Approximately 73.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0 or PBS, 6% Irehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.