GSK-3 beta Protein, Human (P. pastoris, His)

GSK-3 beta is an active protein kinase that regulates a variety of cellular processes. It negatively regulates glucose homeostasis, Wnt signaling, and transcription factors by phosphorylating substrates such as glycogen synthase, CTNNB1, and JUN. GSK-3 beta Protein, Human (P. pastoris, His) is the recombinant human-derived GSK-3 beta protein, expressed by P. pastoris , with N-6*His labeled tag.

GSK-3 beta, a constitutively active protein kinase, plays a multifaceted role in regulating diverse cellular processes. It serves as a negative regulator in hormonal control of glucose homeostasis, Wnt signaling, and transcription factors, exerting its effects by phosphorylating and inactivating key substrates such as glycogen synthase, EIF2B, CTNNB1/beta-catenin, APC, AXIN1, DPYSL2/CRMP2, JUN, NFATC1/NFATC, MAPT/TAU, and MACF1. In skeletal muscle, it contributes to insulin regulation of glycogen synthesis. GSK-3 beta's involvement in Wnt signaling leads to CTNNB1 degradation, while its phosphorylation of JUN and NFATC1/NFATC modulates their activity. The kinase also plays crucial roles in microtubule dynamics, influencing MAPT/TAU stability and contributing to ERBB2-dependent microtubule stabilization. Additionally, GSK-3 beta participates in diverse pathways such as NF-kappa-B regulation, pancreatic beta-cell replication, and apoptosis control through interactions with MCL1 and SNAI1. Furthermore, it orchestrates circadian rhythms, autophagy, and extrinsic apoptotic signaling, highlighting its central role in cellular homeostasis and response to external stimuli.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

P. pastoris

N-6*His

P49841-1 (M1-T420)

2932  [NCBI]

MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST

50 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.