H2AC4 Protein, Human

The H2AC4 protein is a core component of nucleosomes, which compress DNA into chromatin and restrict DNA entry into cellular processes. H2AC4 Protein, Human is the recombinant human-derived H2AC4 protein, expressed by E. coli , with tag free. The total length of H2AC4 Protein, Human is 129 a.a., with molecular weight of ~14.0 kDa.

H2AC4 protein serves as a core component of the nucleosome, an integral structure that envelops and compacts DNA into chromatin, effectively restricting DNA accessibility to cellular machineries requiring DNA as a template. Histones, including H2AC4, assume a pivotal role in key cellular processes such as transcription regulation, DNA repair, DNA replication, and the maintenance of chromosomal stability. The intricate regulation of DNA accessibility involves a complex network of post-translational modifications, collectively known as the histone code, and dynamic nucleosome remodeling. The nucleosome itself comprises a histone octamer, consisting of two molecules each of H2A, H2B, H3, and H4, arranged in one H3-H4 heterotetramer and two H2A-H2B heterodimers. This octamer efficiently wraps approximately 147 base pairs of DNA, underscoring its fundamental role in organizing chromatin structure and facilitating genomic functions.

Human

E. coli

Tag Free

P04908 (S2-K130)

3012  [NCBI]

SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

Approximately 14.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.