HABP1/C1QBP Protein, Human (His)

HABP1/C1QBP Protein, Human (His) is a recombinant human HABP1 (hyaluronan-binding protein 1)/C1QBP (complement component 1, q subcomponent binding protein) produced in HEK293 cells, with His tag. HABP1/C1QBP is a ubiquitously present glycoprotein having specific affinity towards hyaluronan (HA)^[1].

HABP1/C1QBP is a multi-functional, multicompartmental glycoprotein. HABP1/C1QBP shows distinct functions in cellular processes ranging from immunological response, splicing mechanism, sperm-oocyte interactions, and cell cycle regulation to cancer^[1].

Human

E. coli

C-6*His

Q07021 (L74-Q282)

708  [NCBI]

LHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQHHHHHH

Approximately 31 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filter solution of 20 mM Tris, 20% Glycerol, 1 mM DTT, pH 7.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Paramita Saha, et al. Multi-functional, multicompartmental hyaluronan-binding protein 1 (HABP1/p32/gC1qR): implication in cancer progression and metastasis. Oncotarget. 2018 Feb 13; 9(12): 10784–10807.  [Content Brief]