HAI-2 Protein, Mouse (HEK293, His)

HAI-2 Protein functions as an inhibitor for various proteases, including HGFAC, plasmin, and plasma kallikrein.It also inhibits TMPRSS13 and ST14/matriptase, regulating their serine protease activity.The interaction with TMPRSS13 promotes its phosphorylation and cell membrane localization.HAI-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived HAI-2 protein, expressed by HEK293 , with C-His labeled tag.

HAI-2 Protein acts as an inhibitor of several proteins, including HGFAC, plasmin, and plasma and tissue kallikrein, thereby regulating their activity. It also inhibits the serine protease activity of TMPRSS13 and ST14/matriptase in vitro. HAI-2 Protein interacts with TMPRSS13, promoting its phosphorylation and facilitating its localization to the cell membrane.

Measured by its ability to inhibit trypsin cleavage of a fluorogenic peptide substrate, Mca-RPKPVE-Nval-WRK(Dnp)-NH2. The IC₅₀ value is 1.822 nM, as measured under the described conditions.

Mouse

HEK293

C-6*His

Q9WU03-2 /NP_001076017.1 (A28-K140)

20733  [NCBI]

ASRELDVHENTTDDMARNRNGADSSVLSVPRKQSAEDLSAEIFNYEEYCVPKAVTGPCRAAFPRWYYDTEKNSCISFIYGGCRGNKNSYLSQEACMQHCSGKQMHPFLTPGLK

Approximately 19-22 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.