1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL14
  6. HCC-1/CCL14 Protein, Human (HEK293, His)

HCC-1/CCL14 Protein, Human (HEK293, His) is a CC chemokine with weak activity against human monocytes, promotes monocyte, eosinophil and T-lymphocyte chemotaxis, and mediates allergic airway inflammation and cancer. HCC-1/CCL14 Protein, Human (HEK293, His) is a recombinant human HCC-1/CCL14(T20-N93) expressed by HEK293 with a his tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

HCC-1/CCL14 Protein, Human (HEK293, His) is a CC chemokine with weak activity against human monocytes, promotes monocyte, eosinophil and T-lymphocyte chemotaxis, and mediates allergic airway inflammation and cancer. HCC-1/CCL14 Protein, Human (HEK293, His) is a recombinant human HCC-1/CCL14(T20-N93) expressed by HEK293 with a his tag[1][2].

Background

CCL14, also known as HCC-1, is a human plasma chemokine originally collected and purified from the hemofiltrate of patients with chronic renal failure. CCL14 belongs to the small cytokine family of CC chemokines, a cluster of chemokines located on human chromosome 17 that can be expressed in a variety of tissues, including spleen, bone marrow, liver, muscle, and intestine. CCL14 has weak activity against human monocytes and no activity against T lymphocytes, neutrophils, and eosinophils. CCL14 is weakly active against human monocytes and inactive against T lymphocytes, neutrophils, and eosinophils.CCL14 acts as a protein precursor that requires protein hydrolysis to obtain receptor affinity and is processed to yield a mature active protein containing 74 amino acids. The processed HCC-1(9-74) is a chemokine that attracts monocytes, eosinophils and T cells and binds to CCR1, CCR3 and CCR5 chemokine receptors[2]. Post-translational modifications of CCL14 chemokines, such as N-terminal truncation and glycosylation, also result in differential signaling compared to unmodified ones. For example, both full-length CCL14(1-74) and truncated isoform CCL14(9-74) bind to atypical chemokine receptor 2 (ACKR2), but only truncated CCL14(9-74) shows a propensity for β-restin and induces receptor internalization of ACKR2 compared to CCL14(1-74). Meanwhile, CCL14(1-74) was a weak agonist of chemokine receptor CCR1, but its activity was significantly enhanced after proteolytic cleavage to CCL14(9-74)[1]. CCL14 has been shown to inhibit HCC cell proliferation by inhibiting cell cycle progression and promoting apoptosis in hepatocellular carcinoma (HCC) cells.CCL14 inhibits HCC tumor growth in nude mice in vivo.CCL14 is also involved in the pathogenesis and progression of various diseases, including allergic airway inflammation and some cancers[2].

In Vitro

CCL14 (10 nM, 22 h) can increase trophoblast adhesion to fibronectin by 3-fold and increase expression of extracellular matrix and adhesion molecules such as collagen COL5A1, matrix metalloproteinase MMP12 in human choriocarcinoma-primary trophoblast hybrid AC1M-88 cell line[3].

Biological Activity

Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 5.559 ng/mL, corresponding to a specific activity is 1.798×105 U/mg.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q16627-1 (T20-N93)

Gene ID
Molecular Construction
N-term
CCL14 (T20-N93)
Accession # Q16627-1
6*His
C-term
Synonyms
rHuCCL14, His; C-C Motif Chemokine 14; Chemokine CC-1/CC-3; HCC-1/HCC-3; HCC-1(1-74); NCC-2; Small-Inducible Cytokine A14; CCL14; NCC2; SCYA14
AA Sequence

TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKENHHHHHH

Molecular Weight

Approximately 13 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

HCC-1/CCL14 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HCC-1/CCL14 Protein, Human (HEK293, His)
Cat. No.:
HY-P7763
Quantity:
MCE Japan Authorized Agent: