1. Recombinant Proteins
  2. Others
  3. HE4/WFDC2 Protein, Human (HEK293, His)

The HE4/WFDC2 protein is a homotrimeric broad-spectrum protease inhibitor that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. As a brainstem-restricted receptor, it binds to GDF15 and interacts with RET, activating MAPK and AKT signaling pathways. HE4/WFDC2 Protein, Human (HEK293, His) is the recombinant human-derived HE4/WFDC2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of HE4/WFDC2 Protein, Human (HEK293, His) is 94 a.a., with molecular weight of 18-22 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The HE4/WFDC2 protein is a homotrimeric broad-spectrum protease inhibitor that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. As a brainstem-restricted receptor, it binds to GDF15 and interacts with RET, activating MAPK and AKT signaling pathways. HE4/WFDC2 Protein, Human (HEK293, His) is the recombinant human-derived HE4/WFDC2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of HE4/WFDC2 Protein, Human (HEK293, His) is 94 a.a., with molecular weight of 18-22 kDa.

Background

HE4/WFDC2 protein is a broad range protease inhibitor that forms homotrimers through disulfide linkages. It is involved in various physiological processes, including regulation of food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. This protein acts as a brainstem-restricted receptor and interacts with its ligand, GDF15. Upon binding, HE4/WFDC2 protein interacts with RET and activates MAPK- and AKT-signaling pathways. The extracellular domain of HE4/WFDC2 protein is responsible for interacting with GDF15 and RET, functioning as a receptor for GDF15 and mediating cellular signaling through the interaction with RET following GDF15 binding. Notably, the interaction with RET is dependent on prior binding of GDF15.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q14508 (E31-F124)

Gene ID
Molecular Construction
N-term
HE4 (E31-F124)
Accession # Q14508
6*His
C-term
Synonyms
WAP Four-Disulfide Core Domain Protein 2; Epididymal Secretory Protein E4; Major Epididymis-Specific Protein E4; Putative Protease Inhibitor WAP5; WFDC2; HE4; WAP5
AA Sequence

EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Molecular Weight

18-24 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HE4/WFDC2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HE4/WFDC2 Protein, Human (HEK293, His)
Cat. No.:
HY-P71432
Quantity:
MCE Japan Authorized Agent: