HE4/WFDC2 Protein, Mouse (HEK293, His)

HE4/WFDC2 protein is a disulfide-bonded homotrimer serving as a broad range protease inhibitor. HE4/WFDC2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived HE4/WFDC2 protein, expressed by HEK293, with C-His labeled tag. The total length of HE4/WFDC2 Protein, Mouse (HEK293, His) is 149 a.a., with molecular weight of ~23-30 kDa.

HE4/WFDC2 protein is a broad range protease inhibitor that functions as a homotrimer, connected by disulfide bonds.

Mouse

HEK293

C-His

Q9DAU7 (T26-F174)

67701  [NCBI]

TGTDAEKPGECPQLEPITDCVLECTLDKDCADNRKCCQAGCSSVCSKPNGPSEGELSGTDTKLSETGTTTQSAGLDHTTKPPGGQVSTKPPAVTREGLGVREKQGTCPSVDIPKLGLCEDQCQVDSQCSGNMKCCRNGCGKMACTTPKF

Approximately 23-30 kDa. Glycosylation sites are found in mouse HE4/WFDC2 protein.

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.