1. Recombinant Proteins
  2. Others
  3. HE4/WFDC2 Protein, Mouse (HEK293, His)

HE4/WFDC2 protein is a disulfide-bonded homotrimer serving as a broad range protease inhibitor. HE4/WFDC2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived HE4/WFDC2 protein, expressed by HEK293, with C-His labeled tag. The total length of HE4/WFDC2 Protein, Mouse (HEK293, His) is 149 a.a., with molecular weight of ~23-30 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

HE4/WFDC2 Protein, Mouse (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HE4/WFDC2 protein is a disulfide-bonded homotrimer serving as a broad range protease inhibitor. HE4/WFDC2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived HE4/WFDC2 protein, expressed by HEK293, with C-His labeled tag. The total length of HE4/WFDC2 Protein, Mouse (HEK293, His) is 149 a.a., with molecular weight of ~23-30 kDa.

Background

HE4/WFDC2 protein is a broad range protease inhibitor that functions as a homotrimer, connected by disulfide bonds.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q9DAU7 (T26-F174)

Gene ID
Molecular Construction
N-term
HE4 (T26-F174)
Accession # Q9DAU7
His
C-term
Synonyms
WAP four-disulfide core domain protein 2; HE4; WFDC2
AA Sequence

TGTDAEKPGECPQLEPITDCVLECTLDKDCADNRKCCQAGCSSVCSKPNGPSEGELSGTDTKLSETGTTTQSAGLDHTTKPPGGQVSTKPPAVTREGLGVREKQGTCPSVDIPKLGLCEDQCQVDSQCSGNMKCCRNGCGKMACTTPKF

Molecular Weight

Approximately 23-30 kDa. Glycosylation sites are found in mouse HE4/WFDC2 protein.

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HE4/WFDC2 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HE4/WFDC2 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P75143
Quantity:
MCE Japan Authorized Agent: