1. Recombinant Proteins
  2. Others
  3. Hemoglobin subunit zeta/HBAZ Protein, Human (His)

Hemoglobin subunit zeta/HBAZ Protein, Human (His)

Cat. No.: HY-P70242
COA Handling Instructions

The hemoglobin zeta subunit (HBAZ) protein acts as an α-type chain in mammalian embryonic hemoglobin. It contributes to the formation of heterotetramers and is involved in various developmental stages. Hemoglobin subunit zeta/HBAZ Protein, Human (His) is the recombinant human-derived Hemoglobin subunit zeta/HBAZ protein, expressed by E. coli , with N-6*His labeled tag. The total length of Hemoglobin subunit zeta/HBAZ Protein, Human (His) is 142 a.a., with molecular weight of ~15.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $160 In-stock
50 μg $450 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The hemoglobin zeta subunit (HBAZ) protein acts as an α-type chain in mammalian embryonic hemoglobin. It contributes to the formation of heterotetramers and is involved in various developmental stages. Hemoglobin subunit zeta/HBAZ Protein, Human (His) is the recombinant human-derived Hemoglobin subunit zeta/HBAZ protein, expressed by E. coli , with N-6*His labeled tag. The total length of Hemoglobin subunit zeta/HBAZ Protein, Human (His) is 142 a.a., with molecular weight of ~15.0 kDa.

Background

Hemoglobin subunit zeta (HBAZ) serves as an alpha-type chain within mammalian embryonic hemoglobin. It participates in distinct hemoglobin tetramers during various developmental stages, contributing to the formation of heterotetramers such as two zeta chains and two epsilon chains in early embryonic hemoglobin Gower-1. In fetal hemoglobin Portland-1, it combines with two zeta chains and two gamma chains, while in hemoglobin Portland-2, detected in fetuses and neonates with homozygous alpha-thalassemia, it forms a heterotetramer alongside two zeta chains and two beta chains.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P02008 (M1-R142)

Gene ID
Molecular Construction
N-term
6*His
HBZ (M1-R142)
Accession # P02008
C-term
Synonyms
rHuHemoglobin subunit zeta/HBAZ, His; Hemoglobin Subunit Zeta; HBAZ; Hemoglobin Zeta Chain; Zeta-Globin; HBZ; HBZ2
AA Sequence

MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR

Molecular Weight

Approximately 15.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 2 mM DTT, 10% Glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Hemoglobin subunit zeta/HBAZ Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Hemoglobin subunit zeta/HBAZ Protein, Human (His)
Cat. No.:
HY-P70242
Quantity:
MCE Japan Authorized Agent: