Hemoglobin subunit zeta/HBAZ Protein, Human (His)

The hemoglobin zeta subunit (HBAZ) protein acts as an α-type chain in mammalian embryonic hemoglobin. It contributes to the formation of heterotetramers and is involved in various developmental stages. Hemoglobin subunit zeta/HBAZ Protein, Human (His) is the recombinant human-derived Hemoglobin subunit zeta/HBAZ protein, expressed by E. coli , with N-6*His labeled tag. The total length of Hemoglobin subunit zeta/HBAZ Protein, Human (His) is 142 a.a., with molecular weight of ~15.0 kDa.

Hemoglobin subunit zeta (HBAZ) serves as an alpha-type chain within mammalian embryonic hemoglobin. It participates in distinct hemoglobin tetramers during various developmental stages, contributing to the formation of heterotetramers such as two zeta chains and two epsilon chains in early embryonic hemoglobin Gower-1. In fetal hemoglobin Portland-1, it combines with two zeta chains and two gamma chains, while in hemoglobin Portland-2, detected in fetuses and neonates with homozygous alpha-thalassemia, it forms a heterotetramer alongside two zeta chains and two beta chains.

Human

E. coli

N-6*His

P02008 (M1-R142)

3050  [NCBI]

MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR

Approximately 15.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 2 mM DTT, 10% Glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.