1. Recombinant Proteins
  2. Others
  3. Histone H4 Protein, Human/Xenopus laevis

Histone H4 proteins are core components of nucleosomes, which compact DNA into chromatin and regulate DNA accessibility during cellular processes. Histones, including H4, play critical roles in transcriptional regulation, DNA repair, replication, and chromosome stability. Histone H4 Protein, Human/Xenopus laevis is the recombinant Xenopus laevis-derived Histone H4 protein, expressed by E. coli , with tag free. The total length of Histone H4 Protein, Human/Xenopus laevis is 102 a.a., with molecular weight of ~11 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Histone H4 proteins are core components of nucleosomes, which compact DNA into chromatin and regulate DNA accessibility during cellular processes. Histones, including H4, play critical roles in transcriptional regulation, DNA repair, replication, and chromosome stability. Histone H4 Protein, Human/Xenopus laevis is the recombinant Xenopus laevis-derived Histone H4 protein, expressed by E. coli , with tag free. The total length of Histone H4 Protein, Human/Xenopus laevis is 102 a.a., with molecular weight of ~11 kDa.

Background

Histone H4 protein serves as a core component of the nucleosome, a fundamental unit in chromatin architecture responsible for wrapping and compacting DNA, thereby restricting its accessibility to cellular machineries reliant on DNA templates. Histones, including H4, hold a central role in vital cellular processes such as transcription regulation, DNA repair, DNA replication, and maintenance of chromosomal stability. The intricate regulation of DNA accessibility involves a complex array of post-translational modifications, collectively known as the histone code, and dynamic nucleosome remodeling. The nucleosome structure comprises a histone octamer containing two H2A, H2B, H3, and H4 molecules each, organized into one H3-H4 heterotetramer and two H2A-H2B heterodimers. This octamer wraps approximately 147 base pairs of DNA. Additionally, Histone H4 participates in a co-chaperone complex with DNJC9, MCM2, and histone H3.3-H4 dimers, interacting directly with DNJC9 within the complex.

Species

Xenopus laevis; Human

Source

E. coli

Tag

Tag Free

Accession

P62805 (S2-G103)

Gene ID
Molecular Construction
N-term
Histone H4 (S2-G103)
Accession # P62805
C-term
Synonyms
H4C1
AA Sequence

SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Molecular Weight

Approximately 11 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of ddH2O, pH 7.0 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Histone H4 Protein, Human/Xenopus laevis Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Histone H4 Protein, Human/Xenopus laevis
Cat. No.:
HY-P72336
Quantity:
MCE Japan Authorized Agent: