1. Recombinant Proteins
  2. Others
  3. HLA-DPB1 Protein, Human (His)

The HLA-DPB1 protein is an integral part of the immune system, binding antigens in the endocytic pathway of antigen-presenting cells (APCs). It presents the peptide on the cell surface for recognition by CD4 T cells. HLA-DPB1 Protein, Human (His) is the recombinant human-derived HLA-DPB1 protein, expressed by E. coli , with N-His labeled tag. The total length of HLA-DPB1 Protein, Human (His) is 194 a.a., with molecular weight of ~26.8 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The HLA-DPB1 protein is an integral part of the immune system, binding antigens in the endocytic pathway of antigen-presenting cells (APCs). It presents the peptide on the cell surface for recognition by CD4 T cells. HLA-DPB1 Protein, Human (His) is the recombinant human-derived HLA-DPB1 protein, expressed by E. coli , with N-His labeled tag. The total length of HLA-DPB1 Protein, Human (His) is 194 a.a., with molecular weight of ~26.8 kDa.

Background

The HLA-DPB1 Protein plays a pivotal role in the immune system by binding peptides derived from antigens within the endocytic route of antigen-presenting cells (APCs) and presenting them on the cell surface for recognition by CD4 T-cells. The peptide binding cleft of HLA-DPB1 accommodates peptides ranging from 10 to 30 residues, predominantly generated through the degradation of proteins accessing the endocytic route. This exogenous antigen presentation pathway involves lysosomal proteases and other hydrolases processing antigens taken up by APCs. Notably, cells of the gastrointestinal tract, including epithelial cells, express MHC class II molecules and CD74, acting as unconventional APCs. The assembly of a functional MHC class II molecule involves the association of three MHC class II molecules with a CD74 trimer in the endoplasmic reticulum (ER), forming a heterononamer. Upon entering the endosomal/lysosomal system, CD74 undergoes sequential degradation, leaving a fragment known as CLIP on each MHC class II molecule. HLA-DM facilitates CLIP removal, stabilizing MHC class II until high-affinity antigenic peptides bind. HLA-DO regulates the interaction between HLA-DM and MHC class II in B-cells, and lysosomal acidification influences efficient peptide loading. The MHC class II molecule, bound to a peptide, is then transported to the cell membrane surface for immune recognition.

Species

Human

Source

E. coli

Tag

N-His

Accession

P04440 (R30-R223)

Gene ID
Molecular Construction
N-term
His
HLA-DPB1 (R30-R223)
Accession # P04440
C-term
Synonyms
HLA class II histocompatibility antigen; HLA class II histocompatibility antigen; DP beta 1 chain; HLA class II histocompatibility antigen; HLA-DP1B; HLA-DPB
AA Sequence

RATPENYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSAR

Molecular Weight

Approximately 26.8 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HLA-DPB1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HLA-DPB1 Protein, Human (His)
Cat. No.:
HY-P71696
Quantity:
MCE Japan Authorized Agent: