HLP2/HPCAL1 Protein, Human (His)

The HLP2/HPCAL1 protein emerged as a potential regulator of calcium-dependent rhodopsin phosphorylation, suggesting a role in regulating this critical process of visual signal transduction. Its complex interactions with calcium-mediated pathways suggest its importance in the precise control of rhodopsin function, influencing visual signaling. HLP2/HPCAL1 Protein, Human (His) is the recombinant human-derived HLP2/HPCAL1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of HLP2/HPCAL1 Protein, Human (His) is 193 a.a., with molecular weight of ~21.0 kDa.

HLP2/HPCAL1 Protein emerges as a potential player in the finely tuned calcium-dependent regulation of rhodopsin phosphorylation. Its involvement suggests a role in modulating the phosphorylation dynamics of rhodopsin, a crucial process in the regulation of visual signal transduction. The intricate interplay between HLP2/HPCAL1 and calcium-mediated pathways hints at its potential significance in the precise control of rhodopsin function and, consequently, visual signaling. Unraveling the specific mechanisms through which HLP2/HPCAL1 contributes to rhodopsin phosphorylation may offer valuable insights into the molecular intricacies of visual signal processing and the broader regulatory mechanisms in sensory perception. Exploring the functional significance of HLP2/HPCAL1 in the context of calcium-dependent rhodopsin regulation could deepen our understanding of its role in maintaining visual sensitivity and adaptation.

Human

E. coli

N-6*His

P37235 (M1-F193)

3241  [NCBI]

MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF

Approximately 21.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.