1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. HMGCR Protein, Human (His)

As a key enzyme in cholesterol biosynthesis, HMGCR protein plays a central role in regulating cellular cholesterol levels. It catalyzes the conversion of HMG-CoA to mevalonate, a key step in the synthesis of cholesterol and other isoprenoids. HMGCR Protein, Human (His) is the recombinant human-derived HMGCR protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE HMGCR Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

As a key enzyme in cholesterol biosynthesis, HMGCR protein plays a central role in regulating cellular cholesterol levels. It catalyzes the conversion of HMG-CoA to mevalonate, a key step in the synthesis of cholesterol and other isoprenoids. HMGCR Protein, Human (His) is the recombinant human-derived HMGCR protein, expressed by E. coli , with N-6*His labeled tag.

Background

Cyclophilin A protein serves as a catalyst for the cis-trans isomerization of proline imidic peptide bonds within oligopeptides. Beyond its enzymatic role, it exerts diverse cellular effects, including a potent chemotactic influence on leukocytes, mediated in part through the activation of its membrane receptor BSG/CD147, initiating a signaling cascade leading to MAPK/ERK activation. The protein also activates endothelial cells (ECs) in a pro-inflammatory manner, inducing NF-kappa-B and MAP-kinase pathways and promoting the expression of adhesion molecules. Furthermore, Cyclophilin A induces apoptosis in ECs by modulating the expression of key factors involved in chemotaxis and apoptosis. In response to oxidative stress, it initiates both proapoptotic and antiapoptotic signaling in ECs, highlighting its multifaceted role. The protein negatively regulates MAP3K5/ASK1 kinase activity and is crucial for the assembly of TARDBP in heterogeneous nuclear ribonucleoprotein complexes, influencing TARDBP binding to RNA and regulating the expression of associated genes. Additionally, Cyclophilin A plays a significant role in platelet activation and aggregation, as well as in the regulation of calcium mobilization and integrin ITGA2B:ITGB3 bidirectional signaling through increased ROS production and facilitation of integrin-cytoskeleton interaction. It also exhibits binding affinity for heparan sulfate glycosaminoglycans.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P04035-1 (M588-T887)

Gene ID
Molecular Construction
N-term
6*His
HMGCR (M588-T887)
Accession # P04035-1
C-term
Synonyms
3 hydroxy 3 methylglutaryl CoA reductase; 3 hydroxy 3 methylglutaryl Coenzyme A reductase; 3 hydroxymethylglutaryl CoA reductase; 3-hydroxy-3-methylglutaryl CoA reductase NADPH; ; 3-hydroxy-3-methylglutaryl-coenzyme A reductase; 3H3M; HMDH_HUMAN; HMG CoA reductase; HMG CoAR; HMG-CoA reductase; Hmgcr; Hydroxymethylglutaryl CoA reductase; LDLCQ3; MGC103269; Red
AA Sequence

MTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGACTKKT

Molecular Weight

Approximately 38 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

HMGCR Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HMGCR Protein, Human (His)
Cat. No.:
HY-P72228
Quantity:
MCE Japan Authorized Agent: