1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Stimulatory Immune Checkpoint Molecules T Cell CD Proteins
  4. ICOS/CD278 ICOS/CD278
  5. ICOS Protein, Mouse (C137S, C138S, HEK293, Fc)

ICOS Protein, Mouse (C137S, C138S, HEK293, Fc)

Cat. No.: HY-P78673
Handling Instructions Technical Support

ICOS proteins optimize T cell responses to foreign antigens, promoting proliferation, lymphokine secretion, upregulation of cell-cell interaction molecules, and efficient B cell antibody secretion. ICOS is essential for efficient communication of T cells and B cells and for normal antibody responses to T cell-dependent antigens. ICOS Protein, Mouse (C137S, C138S, HEK293, Fc) is the recombinant mouse-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag and C137S, C138S, , , mutation.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ICOS proteins optimize T cell responses to foreign antigens, promoting proliferation, lymphokine secretion, upregulation of cell-cell interaction molecules, and efficient B cell antibody secretion. ICOS is essential for efficient communication of T cells and B cells and for normal antibody responses to T cell-dependent antigens. ICOS Protein, Mouse (C137S, C138S, HEK293, Fc) is the recombinant mouse-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag and C137S, C138S, , , mutation.

Background

The ICOS protein enhances all fundamental T-cell responses to foreign antigens, including proliferation, secretion of lymphokines, up-regulation of cell-cell interaction molecules, and providing effective help for antibody secretion by B-cells. It is essential for facilitating efficient communication between T and B-cells and for normal antibody responses to T-cell dependent antigens. Although it does not increase the production of interleukin-2, it superinduces the synthesis of interleukin-10. Additionally, it prevents apoptosis of pre-activated T-cells and plays a critical role in CD40-mediated class switching of immunoglobulin isotypes. ICOS exists as a homodimer, connected by disulfide bonds.

Biological Activity

1. Immobilized Human B7-H2 His at 1 μg/mL (100 μL/well) can bind Mouse ICOS (C137S C138S, Fc) with a linear range of 0.3-10 ng/mL.
2. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse ICOS at 1 μg/mL (100 μL/well) can bind Biotinylated Recombinant Human rhB7-H2. The ED50 for this effect is 37.18 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse ICOS at 1 μg/mL (100 μL/well) can bind Biotinylated Recombinant Human rhB7-H2 .The ED50 for this effect is 37.18 ng/mL.
Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q9WVS0 (E21-L144, C137S, C138S)

Gene ID
Molecular Construction
N-term
ICOS (E21-L144, C137S, C138S)
Accession # Q9WVS
hFc
C-term
Synonyms
ICOS; CD278; AILIM; Inducible T-cell costimulator
AA Sequence

EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLSSQLKLWL

Molecular Weight

40-52 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of Tris with Glycine, Arginine and NaCl, pH 7.5. Normally trehalose is added as protectant before lyophilization. or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ICOS Protein, Mouse (C137S, C138S, HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ICOS Protein, Mouse (C137S, C138S, HEK293, Fc)
Cat. No.:
HY-P78673
Quantity:
MCE Japan Authorized Agent: