ICOS Protein, Rat (HEK293, Fc)

ICOS is a key protein for T cell function and can significantly enhance various T cell responses to foreign antigens. It plays a crucial role in promoting T cell proliferation, lymphokine secretion and upregulation of intercellular interaction molecules, and promoting efficient secretion of B cell antibodies. ICOS Protein, Rat (HEK293, Fc) is the recombinant rat-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag.

ICOS, an essential protein in T-cell function, significantly enhances various T-cell responses to foreign antigens. It plays a pivotal role in promoting T-cell proliferation, secretion of lymphokines, up-regulation of cell-cell interaction molecules, and efficient assistance for B-cell antibody secretion. Notably, ICOS is indispensable for the normal antibody responses to T-cell dependent antigens, fostering the interaction between T and B-cells. Interestingly, ICOS does not elevate interleukin-2 production but superinduces the synthesis of interleukin-10. Additionally, it serves a crucial function in preventing the apoptosis of pre-activated T-cells and plays a significant role in CD40-mediated class switching of immunoglobulin isotypes. The protein forms homodimers through disulfide linkages, contributing to its multifaceted role in modulating immune responses.

Measured by its ability to inhibit Jurkat proliferation induced by B7-H2 in the presence of anti-CD3. The ED₅₀ for this effect is 3.252 µg/mL in the presence of 3 µg/mL Human B7‑H2 and 20 ng/mL of anti-CD3, corresponding to a specific activity is 307.503 units/mg.

• 
  Measured by its ability to inhibit Jurkat proliferation induced by B7-H2 in the presence of anti-CD3. The ED₅₀ for this effect is 3.252 µg/mL in the presence of 3 µg/mL Human B7-H2 and 20 ng/mL of anti-CD3, corresponding to a specific activity is 307.503 units/mg.

Rat

HEK293

C-hFc

Q9R1T7-1 (E21-L142)

64545  [NCBI]

ELNDLANHRMFSFHDGGVQISCNYPETVQQLKMQLFKDREVLCDLTKTKGSGNTVSIKNPMSCPYQLSNNSVSFFLDNADSSQGSYFLCSLSIFDPPPFQEKNLSGGYLLIYESQLCCQLKL

Approximately 43-50 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.