IFN-alpha 14/IFNA14 Protein, Human (His-SUMO)

IFN-alpha 14 (IFNA14), belongs to type I interferon family, is produced by macrophages with antiviral activities^[1]. IFN-alpha 14/IFNA14 Protein, Human (His-SUMO) contains 166 a.a. (C24-D189), produced in E. coli cells with a N-terminal His-SUMO tag.

IFN-alpha 14 (IFNA14; IFN-α14), belongs to the alpha/beta interferon (IFN) family, is produced by the macrophages with antiviral activities^[1]. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively^[2].
Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Interferon alpha (IFNa) shows significant biological activity in various cancers, paticularly haematological malignancies such as hairy cell leukaemia and chronic myelogenous leukaemia^[3].
IFN-alpha 14 involves in JAK/STAT signaling pathway, is identified as potent regulators that reduces both CTLA4 and FOXP3. Therefore, regulatory T cells (Tregs) as the key cells regulating peripheral autoreactive T lymphocytes, IFNα-14 regulates Treg functional states and destabilises Treg^[4].
IFN-alpha14 is a new gene found in tissues of uninfected mice, also found to lack N-glycosylation and have its expression induced in response to viral infection in contrast to IFN-alpha 13^[5].

IFN-alpha 14 (10 pM-10 μM; 24-26 h) results signifcant reduction of both CTLA4 and FOXP3 gene expression in regulatory T cells (Tregs) without affecting cell viability^[4].

Human

E. coli

N-6*His;N-SUMO

P01570 (C24-D189)

3448  [NCBI]

CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD

Approximately 35.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Kumagai Y, et al. Alveolar macrophages are the primary interferon-alpha producer in pulmonary infection with RNA viruses. Immunity. 2007 Aug;27(2):240-52.  [Content Brief]

  [2]. Zhang SY, et al. Inborn errors of interferon (IFN)-mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40.  [Content Brief]

  [3]. Raj NB, et al. Identification of a novel virus-responsive sequence in the promoter of murine interferon-alpha genes. J Biol Chem. 1991 Jun 15;266(17):11360-5.  [Content Brief]

  [4]. Ding M, et al. Secretome screening reveals immunomodulating functions of IFNα-7, PAP and GDF-7 on regulatory T-cells. Sci Rep. 2021 Aug 18;11(1):16767.  [Content Brief]

  [5]. van Pesch V, et al. Characterization of interferon-alpha 13, a novel constitutive murine interferon-alpha subtype. J Biol Chem. 2003 Nov 21;278(47):46321-8.  [Content Brief]