IFN-gamma Protein, Rat

IFN-gamma Protein, Rat is a pro-inflammatory cytokine with potent immunomodulatory, anti-proliferative, and antiviral properties.

Interferon-gamma (IFN-γ) is a cytokine with potent immunomodulatory, anti-proliferative, and antiviral properties. IFN-γ activates cells via a different receptor than IFN-α and IFN-β, which accounts for the different physiological properties of the proteins. Production of IFN-γ is largely restricted to activated CD4⁺ TH1 T cells, CD8⁺ T cells, and natural killer cells. One of the most important consequences of IFN-γ secretion is the activation of macrophages. In addition, IFN-γ plays a central role in inflammatory responses by activating endothelial cells, promoting TH1 cell development and cellular immune responses, and up-regulation of major histocompatability complex protein expression on antigen-presenting cells^[1].

1.The ED₅₀ is <0.5 ng/mL as measured by WEHI-279 cells, corresponding to a specific activity of >2 × 10⁶ units/mg.
2.Measured by its binding ability in a functional ELISA. Immobilized rat IFN gamma at 10 μg/mL (100 μL/well) can bind biotinylated rat IFN gamma R1. The ED₅₀ for this effect is 35.05 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized rat IFN gamma at 10 μg/ml (100 μL/well) can bind biotinylated rat IFN gamma R1. The ED₅₀ for this effect is 35.05 ng/mL.

Rat

E. coli

Tag Free

P01581 (G24-C156)

25712  [NCBI]

GTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

Approximately 14-15.5 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS or PBS, pH 7.4, 5% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O or PBS.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34(10):759-68.  [Content Brief]