IGF-I Protein, Salmon

IGF-I protein is similar to insulin and exerts effective growth-promoting activity as a ligand of IGF1R. Binding to the α subunit of IGF1R activates intrinsic tyrosine kinase, triggering autophosphorylation of the β subunit. IGF-I Protein, Salmon is the recombinant IGF-I protein, expressed by E. coli , with tag free. The total length of IGF-I Protein, Salmon is 70 a.a., with molecular weight of ~8 kDa.

The IGF-I protein, structurally and functionally related to insulin, exhibits significantly higher growth-promoting activity. Serving as a ligand for IGF1R, it binds to the alpha subunit of IGF1R, triggering the activation of the intrinsic tyrosine kinase activity. This activation leads to the autophosphorylation of tyrosine residues in the beta subunit, initiating a cascade of downstream signaling events that activate the PI3K-AKT/PKB and Ras-MAPK pathways. IGF-I also binds to integrins, forming a ternary complex with integrins and IGFR1, which proves essential for IGF1 signaling. This intricate molecular interaction highlights the multifaceted role of IGF-I in mediating cellular responses and growth-promoting functions.

Measure by its ability by a dose-response proliferation assay using human FDC-P1 cells. The ED50 for this effect is <15 ng/mL. The specific activity of this protein is > 6.7 × 10⁴ IU/mg. (It is recommended to experimentally determine the optimal concentration for each specific application by performing a dose response assay.)

Others

E. coli

Tag Free

Q02815 (G45-A114)

100136741

GPETLCGAELVDTLQFVCGERGFYFSKPTGYGPSSRRSHNRGIVDECCFQSCELRRLEMYCAPVKSGKAA

Approximately 8 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

< 0.2 EU/μg of protein by gel clotting method

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.