1. Recombinant Proteins
  2. Others
  3. IL-10 Protein, Canine

IL-10 is the most important cytokine that inhibits pro-inflammatory responses and limits excessive immune responses in various autoimmune diseases. It belongs to the type 2 cytokine superfamily. IL-10 plays an important role in transmitting information, activating and regulating immune cells, mediating T and B cell activation, proliferation and differentiation, and in inflammatory responses. IL-10 can promote the proliferation and activation of CD8T+ cells, enhancing anti-tumor capabilities. IL-10 Protein, Canine is the recombinant canine-derived IL-10 protein, expressed by E. coli , with tag free. The total length of IL-10 Protein, Canine is 160 a.a..

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-10 is the most important cytokine that inhibits pro-inflammatory responses and limits excessive immune responses in various autoimmune diseases. It belongs to the type 2 cytokine superfamily. IL-10 plays an important role in transmitting information, activating and regulating immune cells, mediating T and B cell activation, proliferation and differentiation, and in inflammatory responses. IL-10 can promote the proliferation and activation of CD8T+ cells, enhancing anti-tumor capabilities. IL-10 Protein, Canine is the recombinant canine-derived IL-10 protein, expressed by E. coli , with tag free. The total length of IL-10 Protein, Canine is 160 a.a..

Background

IL-10 is the most important cytokine that inhibits pro-inflammatory responses and limits excessive immune reactions in various autoimmune diseases. IL-10 plays a crucial role in delivering messages, activating and regulating immune cells, mediating T and B cell activation, proliferation and differentiation, and in inflammatory responses. IL-10 can suppress the production of cytokines by TH1 cells and antigen-presenting cells (macrophages and dendritic cells). Additionally, IL-10 not only directly inhibits pro-inflammatory TH17 cells, but also has a direct effect on CD4+Foxp3+ regulatory T cells (Tregs) and promotes their suppressive function. When IL-10 binds to its receptor complex, JAK1 (located on the IL-10Rα chain) and Tyk2 (located on the IL-10Rβ chain) are activated. This further leads to the phosphorylation of STAT3 and the expression of downstream genes such as SOCS-1 and SOCS-3. IL-10 can downregulate the expression of major histocompatibility complex II on monocytes, reducing their antigen-presenting function. It can also downregulate T lymphocyte activity, inhibit the activation, migration, and adhesion of inflammatory cells. At the same time, IL-10 can suppress the synthesis and release of inflammatory cytokines. IL-10 can promote the proliferation and activation of CD8T+ cells, enhancing their anti-tumor capacity[1].

Biological Activity

Measured in a cell proliferation assay using HepG2. The ED50 for this effect is 3.15 ng/mL. corresponding to a specific activity is 3.17×105 units/mg.

  • Measured in a cell proliferation assay using HepG2. The ED50 for this effect is 3.15 ng/mL. corresponding to a specific activity is 3.17×105 units/mg.
Species

Canine

Source

E. coli

Tag

Tag Free

Accession

XP_855560 (S20-I179)

Gene ID
Molecular Construction
N-term
IL-10 (S20-I179)
Accession # XP_855560
C-term
Synonyms
IL10; CSIF; CSIFMGC126450; Cytokine synthesis inhibitory factor; IL10A; IL-10MGC126451; interleukin-10; TGIF; Interleukin 10
AA Sequence

SRHQSTLPEDDCTHFPASLPHMLRELRAAFGRVKTFFQMKDKLDNILLTGSLLEDFKSYLGCQALSEMIQFYLEEVMPRAENHDPDIKNHVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVEQVKSAFSKLQEKGVYKAMSEFDIFINYIETYMTMRMKI

Molecular Weight

Approximately 18.9 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 10 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-10 Protein, Canine Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-10 Protein, Canine
Cat. No.:
HY-P79268
Quantity:
MCE Japan Authorized Agent: