IL-11R alpha Protein, Mouse (HEK293, His)

IL-11R alpha (IL-11RA) is the IL-11 receptor subunit α and also acts as an agonist of IL-11. IL-11R alpha binds to IL6ST/gp130 on cell surfaces and induces signal transduction^[1]. IL-11R alpha activates Jak family of tyrosine kinases, JAK1, JAK2, and TYK2^[3]. IL-11R alpha induces proliferation and/or differentiation of skeletogenic progenitor or other mesenchymal cells^[4]. IL-11R alpha plays an important role in the progression and the differentiation of human gastric carcinomas^[5]. IL-11R alpha Protein, Mouse (HEK293, His) is a recombinant protein with a His label that consists of 344 amino acids (S24-Q367) and is produced by HEK293 cells.

IL-11RA is highly expressed on stromal cells, including fibroblasts, smooth muscle cells, adipocytes, and hepatic/pancreatic stellate cells or pericytes, and also on epithelial/polarized cells, such as hepatocytes, alveolar epithelial cells, and kidney tubular epithelial cells^[1].
The amino acid sequence of human IL-11R alpha protein has low homology between mouse and rat IL-11R alpha protein.
IL-11R alpha is the receptor of IL-11, and signaling mechanism triggered by IL-11 is mediated through IL-11R alpha. IL-11R alpha can bind IL-11 and then the comples attracts gp130 leading to signal transduction. Besides, IL11RA has been demonstrated to activate IL-11-mediated gp130 signaling but not the naturally occurring form of the soluble IL-11 receptor. Binding of IL-11 to IL11RA triggers heterodimerization, tyrosine phosphorylation, and activation of gp130. The activated IL11RA–gp130 receptor complex further activates Jak family of tyrosine kinases, JAK1, JAK2, and TYK2^[3].
IL-11R alpha also acts as IL-11 agonist in vitro^[3]. IL-11R alpha induces proliferation and/or differentiation of skeletogenic progenitor or other mesenchymal cells^[4][5].

Mouse

HEK293

C-6*His

Q64385 (S24-Q367)

16157  [NCBI]

SPCPQAWGPPGVQYGQPGRPVMLCCPGVSAGTPVSWFRDGDSRLLQGPDSGLGHRLVLAQVDSPDEGTYVCQTLDGVSGGMVTLKLGFPPARPEVSCQAVDYENFSCTWSPGQVSGLPTRYLTSYRKKTLPGAESQRESPSTGPWPCPQDPLEASRCVVHGAEFWSEYRINVTEVNPLGASTCLLDVRLQSILRPDPPQGLRVESVPGYPRRLHASWTYPASWRRQPHFLLKFRLQYRPAQHPAWSTVEPIGLEEVITDAVAGLPHAVRVSARDFLDAGTWSAWSPEAWGTPSTGPLQDEIPDWSQGHGQQLEAVVAQEDSPAPARPSLQPDPRPLDHRDPLEQ

40-55 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Schafer S, et al. IL-11 is a crucial determinant of cardiovascular fibrosis. Nature. 2017 Dec 7;552(7683):110-115.

  [2]. [2]Cook SA, et al. Hiding in Plain Sight: Interleukin-11 Emerges as a Master Regulator of Fibrosis, Tissue Integrity, and Stromal Inflammation. Annu Rev Med. 2020 Jan 27;71:263-276.  [Content Brief]

  [3]. Balakrishnan L, et al. IL-11/IL11RA receptor mediated signaling: a web accessible knowledgebase. Cell Commun Adhes. 2013 Aug;20(3-4):81-6.  [Content Brief]

  [4]. Dams-Kozlowska H, et al. A designer hyper interleukin 11 (H11) is a biologically active cytokine. BMC Biotechnol. 2012 Mar 21;12:8.  [Content Brief]

  [5]. Nakayama T, et al. Expression of interleukin-11 (IL-11) and IL-11 receptor alpha in human gastric carcinoma and IL-11 upregulates the invasive activity of human gastric carcinoma cells. Int J Oncol. 2007 Apr;30(4):825-33.  [Content Brief]