1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-11 Receptor
  5. IL-11R alpha
  6. IL-11R alpha Protein, Rat (HEK293, His)

IL-11R alpha Protein, Rat (HEK293, His)

Cat. No.: HY-P77400
COA Handling Instructions

IL-11R alpha (IL-11RA) is the IL-11 receptor subunit α and also acts as an agonist of IL-11. IL-11R alpha binds to IL6ST/gp130 on cell surfaces and induces signal transduction. IL-11R alpha activates Jak family of tyrosine kinases, JAK1, JAK2, and TYK2. IL-11R alpha induces proliferation and/or differentiation of skeletogenic progenitor or other mesenchymal cells. IL-11R alpha plays an important role in the progression and the differentiation of human gastric carcinomas. IL-11R alpha Protein, Rat (HEK293, His) is a recombinant protein with a His label that consists of 366 amino acids (M1-Q366) and is produced by HEK293 cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $55 In-stock
50 μg $150 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-11R alpha (IL-11RA) is the IL-11 receptor subunit α and also acts as an agonist of IL-11. IL-11R alpha binds to IL6ST/gp130 on cell surfaces and induces signal transduction[1]. IL-11R alpha activates Jak family of tyrosine kinases, JAK1, JAK2, and TYK2[3]. IL-11R alpha induces proliferation and/or differentiation of skeletogenic progenitor or other mesenchymal cells[4]. IL-11R alpha plays an important role in the progression and the differentiation of human gastric carcinomas[5]. IL-11R alpha Protein, Rat (HEK293, His) is a recombinant protein with a His label that consists of 366 amino acids (M1-Q366) and is produced by HEK293 cells.

Background

IL-11RA is highly expressed on stromal cells, including fibroblasts, smooth muscle cells, adipocytes, and hepatic/pancreatic stellate cells or pericytes, and also on epithelial/polarized cells, such as hepatocytes, alveolar epithelial cells, and kidney tubular epithelial cells[1].
The amino acid sequence of human IL-11R alpha protein has low homology between mouse and rat IL-11R alpha protein.
IL-11R alpha is the receptor of IL-11, and signaling mechanism triggered by IL-11 is mediated through IL-11R alpha. IL-11R alpha can bind IL-11 and then the comples attracts gp130 leading to signal transduction. Besides, IL11RA has been demonstrated to activate IL-11-mediated gp130 signaling but not the naturally occurring form of the soluble IL-11 receptor. Binding of IL-11 to IL11RA triggers heterodimerization, tyrosine phosphorylation, and activation of gp130. The activated IL11RA–gp130 receptor complex further activates Jak family of tyrosine kinases, JAK1, JAK2, and TYK2[3].
IL-11R alpha also acts as IL-11 agonist in vitro[3]. IL-11R alpha induces proliferation and/or differentiation of skeletogenic progenitor or other mesenchymal cells[4][5].

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Rat IL-11R alpha is coated at 2 µg/mL can bind Recombinant Human IL-11. The ED50 for this effect is 0.7710 nM.

Species

Rat

Source

HEK293

Tag

C-6*His

Accession

Q99MF4 /NP_620816.1(T24-Q366)

Gene ID
Molecular Construction
N-term
IL-11Rα (T24-Q366)
Accession # Q99MF4/NP_620816.1
His
C-term
Synonyms
IL-11 R alpha; IL11R alpha; IL11RA; IL-11Ra; Il11ra2; NR1
AA Sequence

TPCPQAWGPPGVQYGQPGRPVMLCCPGVNAGTPVSWFRDGDSRLLQGPDSGLGHRLVLAQVDSRDEGTYVCRTLDGVFGGMVTLKLGSPPARPEVSCQAVDYENFSCTWSPGRVSGLPTRYLTSYRKKTLPGAESQRESPSTGPWPCPQDPLEASRCVVHGAEFWSEYRINVTEVNPLGASTCLLDVRLQRILRPDPPQGLRVESVPGYPRRLHASWTYPASWRRQPHFLLKFRLQYRPAQHPAWSTVEPIGLEELITDAVAGLPHAVRVSARDFLDAGTWSAWSPEAWGTPSTGPLRDEVPDGSRGHEQKLEAAAQEDSPAPPSPSLQPDPRPLDHRDPLEQ

Molecular Weight

Approximately 43-50 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-11R alpha Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-11R alpha Protein, Rat (HEK293, His)
Cat. No.:
HY-P77400
Quantity:
MCE Japan Authorized Agent: