1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-13
  5. IL-13 Protein, Mouse (HEK293, His)

IL-13 protein is a cytokine involved in allergic inflammation, immune response to parasites, and B cell proliferation. IL-13 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-13 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of IL-13 Protein, Mouse (HEK293, His) is 110 a.a., with molecular weight of 14-30 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-13 protein is a cytokine involved in allergic inflammation, immune response to parasites, and B cell proliferation. IL-13 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-13 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of IL-13 Protein, Mouse (HEK293, His) is 110 a.a., with molecular weight of 14-30 kDa.

Background

IL-13 Protein assumes pivotal roles in allergic inflammation and the immune response to parasite infection. It synergizes with IL2 in regulating interferon-gamma synthesis, stimulating B-cell proliferation, and activating eosinophils, basophils, and mast cells. Beyond its immunological functions, IL-13 plays a crucial role in controlling IL33 activity by modulating the production of transmembrane and soluble forms of interleukin-1 receptor-like 1/IL1RL1. It demonstrates the capacity to antagonize Th1-driven proinflammatory immune responses and downregulates the synthesis of various proinflammatory cytokines, including IL1, IL6, IL10, IL12, and TNF-alpha, partly through the suppression of NF-kappa-B. Not confined to hematopoietic cells, IL-13 also acts on nonhematopoietic cells such as endothelial cells, inducing vascular cell adhesion protein 1/VCAM1, which is crucial in the recruitment of eosinophils. Its biological effects are mediated through receptors comprising the IL4R chain and the IL13RA1 chain, activating JAK1 and TYK2, ultimately leading to the activation of STAT6. Besides IL13RA1, another receptor, IL13RA2, acts as a high-affinity decoy for IL-13, mediating internalization and depletion of extracellular IL-13. IL-13 interacts directly with IL13RA2, further illustrating the complexity of its regulatory mechanisms.

Biological Activity

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 1.796 ng/mL, corresponding to a specific activity is 5.568×105 U/mg.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P20109 (P22-F131)

Gene ID
Molecular Construction
N-term
IL-13 (P22-F131)
Accession # P20109
6*His
C-term
Synonyms
Interleukin-13; IL-13; T-Cell Activation Protein P600; Il13
AA Sequence

PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Molecular Weight

14-30 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-13 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-13 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72595
Quantity:
MCE Japan Authorized Agent: