1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. Interleukin & Receptors NK Cell CD Proteins
  4. IL-15 Receptor IL-15R alpha/CD215
  5. IL-15R alpha/CD215
  6. IL-15R alpha Protein, Human (142a.a, HEK293, Fc)

IL-15R alpha Protein, Human (142a.a, HEK293, Fc)

Cat. No.: HY-P72592
Handling Instructions Technical Support

IL-15R alpha is a high affinity receptor for IL-15 (Kd: 100 pM). IL-15R alpha binds IL-15 and thereby activating the antitumor functions of NK cells and CD8+ T cells. IL-15R alpha plays an important role in memory CD8+ T cell homeostasis and lymphocyte development. IL-15R alpha Protein, Human (142a.a, HEK293, Fc) is a recombinant human extracellular region of IL-15R alpha (I31-T172) with a C-Terminal Fc tag, which is produced in HEK293 cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-15R alpha is a high affinity receptor for IL-15 (Kd: 100 pM)[1]. IL-15R alpha binds IL-15 and thereby activating the antitumor functions of NK cells and CD8+ T cells[2]. IL-15R alpha plays an important role in memory CD8+ T cell homeostasis and lymphocyte development[3]. IL-15R alpha Protein, Human (142a.a, HEK293, Fc) is a recombinant human extracellular region of IL-15R alpha (I31-T172) with a C-Terminal Fc tag, which is produced in HEK293 cells.

Background

IL-15R alpha is expressed on various cell types, including lymphocytes, myeloid cells, nonlymphoid and nonhematopoietic cells[4]. IL-15R alpha is down-regulated in Epstein-Barr virus associated gastric cancer (EBVaGC) via promoter hypermethylation[5].
The sequence of amino acids in IL-15R alpha differs in different species. Human IL-15R alpha shares <55% aa sequence identity with mouse.
IL-15R alpha is required for transporting of IL-15 from the endoplasmic reticulum to the cell surface to bind with β (CD122) and γ (CD132) chains on responding lymphocytes[4][6]. When binding with IL-15, the complex increases the in vivo half-life of IL-15 and enhances binding affinity of IL-15 with IL-15Rβ/γ in NK cells and CD8+ T cells. Thus, the signal transmission improves proliferation and antitumor activities of NK cells and CD8+ T cells[2]. Moreover, IL-15R alpha on the cancer cell surface induces the malignant phenotype, such as augmented cancer cell growth, migration and invasion, and decreased apoptosis[5].
IL-15R alpha binds with IL-15 and activates the antitumor functions of NK cells and CD8+ T cells, and is also important in memory CD8 T cell homeostasis and lymphocyte development[2][3].

In Vitro

IL-15R alpha (mouse) exhibits a high level of IL-15 binding with high affinity when transfected to 32D-01 cells[7].

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q13261-3 (I31-T172)

Gene ID
Molecular Construction
N-term
IL-15Rα (I31-T172)
Accession # Q13261-3
hFc
C-term
Synonyms
Interleukin-15 receptor subunit alpha; IL-15R-alpha; IL-15RA; CD215; sIL-15R-alpha; sIL-15RA
AA Sequence

ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIKPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT

Molecular Weight

60-75 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

IL-15R alpha Protein, Human (142a.a, HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-15R alpha Protein, Human (142a.a, HEK293, Fc)
Cat. No.:
HY-P72592
Quantity:
MCE Japan Authorized Agent: