1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins
  3. Interleukin & Receptors NK Cell CD Proteins Cytokine Receptors
  4. IL-15 Receptor IL-15R alpha/CD215
  5. IL-15R alpha/CD215
  6. IL-15R alpha Protein, Mouse (HEK293, hFc)

IL-15R alpha is a high affinity receptor for IL-15 (Kd: 100 pM). IL-15R alpha binds IL-15 and thereby activating the antitumor functions of NK cells and CD8+ T cells. IL-15R alpha plays an important role in memory CD8+ T cell homeostasis and lymphocyte development. IL-15R alpha Protein, Mouse (HEK293, hFc) is a recombinant mouse extracellular region of IL-15R alpha (G33-K205) with a C-Terminal hFc tag, which is produced in HEK293 cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-15R alpha is a high affinity receptor for IL-15 (Kd: 100 pM)[1]. IL-15R alpha binds IL-15 and thereby activating the antitumor functions of NK cells and CD8+ T cells[2]. IL-15R alpha plays an important role in memory CD8+ T cell homeostasis and lymphocyte development[3]. IL-15R alpha Protein, Mouse (HEK293, hFc) is a recombinant mouse extracellular region of IL-15R alpha (G33-K205) with a C-Terminal hFc tag, which is produced in HEK293 cells.

Background

IL-15R alpha is expressed on various cell types, including lymphocytes, myeloid cells, nonlymphoid and nonhematopoietic cells[4]. IL-15R alpha is down-regulated in Epstein-Barr virus associated gastric cancer (EBVaGC) via promoter hypermethylation[5].
The sequence of amino acids in IL-15R alpha differs in different species. Mouse IL-15R alpha shares <55% aa sequence identity with human.
IL-15R alpha is required for transporting of IL-15 from the endoplasmic reticulum to the cell surface to bind with β (CD122) and γ (CD132) chains on responding lymphocytes[4][6]. When binding with IL-15, the complex increases the in vivo half-life of IL-15 and enhances binding affinity of IL-15 with IL-15Rβ/γ in NK cells and CD8+ T cells. Thus, the signal transmission improves proliferation and antitumor activities of NK cells and CD8+ T cells[2]. Moreover, IL-15R alpha on the cancer cell surface induces the malignant phenotype, such as augmented cancer cell growth, migration and invasion, and decreased apoptosis[5]. IL-15R alpha mediates immune responses, and is important for lymphocyte activation and proliferation, NK cell survival and proliferation[7].
IL-15R alpha binds with IL-15 and activates the antitumor functions of NK cells and CD8+ T cells, and is also important in memory CD8 T cell homeostasis and lymphocyte development[2][3].

In Vitro

IL-15R alpha (mouse) exhibits a high level of IL-15 binding with high affinity when transfected to 32D-01 cells[8].

Biological Activity

Measured by its ability to block human IL-15-induced proliferation of CTLL-2 mouse cytotoxic T cells.The ED50 for this effect is <10 ng/mL.

  • Measured by its ability to block human IL-15-induced proliferation of CTLL‑2 mouse cytotoxic T cells. The IC50 for this effect is 0.4892 ng/mL in the presence of 10 ng/mL human IL-15 (HY-P7034).
Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q60819-1 (G33-K205)

Gene ID
Molecular Construction
N-term
IL-15Rα (G33-K205)
Accession # Q60819-1
hFc
C-term
Synonyms
Il15ra; Interleukin-15 receptor subunit alpha; IL-15 receptor subunit alpha; IL-15R-alpha; IL-15RA; CD antigen CD215; Soluble interleukin-15 receptor subunit alpha; sIL-15 receptor subunit alpha; sIL-15R-alpha; sIL-15RA;
AA Sequence

GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK

Molecular Weight

46-90 kDa.

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of 20 mM PB, 150 mM NaCl, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-15R alpha Protein, Mouse (HEK293, hFc) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-15R alpha Protein, Mouse (HEK293, hFc)
Cat. No.:
HY-P71978
Quantity:
MCE Japan Authorized Agent: