IL-17A Protein, Mouse (E. coli)

IL-17A protein is an important effector cytokine that activates the NF-kappa-B and MAPkinase pathways through the IL17RA-IL17RC receptor complex to protect host tissues from microbial threats. As a key Th17 cytokine, IL-17A mediates neutrophil activation, chemotaxis, and contributes to germinal center formation. IL-17A Protein, Mouse (E. coli) is the recombinant mouse-derived IL-17A protein, expressed by E. coli , with tag free.

IL-17A Protein, an effector cytokine, plays a pivotal role in innate and adaptive immune responses, safeguarding host tissues against microbial threats. Signaling through the IL17RA-IL17RC receptor complex, it activates NF-kappa-B and MAPkinase pathways, orchestrating the transcriptional activation of immune effectors. As a hallmark Th17 cytokine, IL-17A mediates neutrophil activation, chemotaxis, and contributes to germinal center formation. It acts as part of an inflammatory circuit, promoting bacterial clearance, and is crucial for epithelial barrier integrity during homeostasis and infection. IL-17A enhances antiviral defense and, in synergy with IL-17F, induces the production of antimicrobial peptides. Its homodimeric and heterodimeric structures highlight its diverse interactions in immune regulation.

Mouse

E. coli

Tag Free

Q62386 (T22-A158)

16171

TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA

Approximately 16 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.